RegulonDB RegulonDB 10.8: Gene Form
   

pepQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadB trkH pepQ yigZ ArcA Fis FadR anti-anti-terminator anti-terminator terminator TSS_4521 (cluster) TSS_4521 (cluster) TSS_4520 TSS_4520 TSS_4519 TSS_4519 pepQp pepQp TSS_4518 TSS_4518 fadBp fadBp

Gene      
Name: pepQ    Texpresso search in the literature
Synonym(s): ECK3839, EG10698, b3847
Genome position(nucleotides): 4031161 --> 4032492 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.68
External database links:  
ASAP:
ABE-0012569
CGSC:
34071
ECHOBASE:
EB0692
OU-MICROARRAY:
b3847
PortEco:
pepQ
STRING:
511145.b3847
COLOMBOS: pepQ


Product      
Name: Xaa-Pro dipeptidase
Synonym(s): PepQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.176
Isoelectric point: 5.893
Motif(s):
 
Type Positions Sequence
168 -> 430 ACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLDHQAPEEMRSFLLDAGAEYNGYAADLTRTWSAKSDNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQVHDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKHFNWQKIEALKPFGGIRIEDNVVIHE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008235 - metalloexopeptidase activity
GO:0008237 - metallopeptidase activity
GO:0016805 - dipeptidase activity
GO:0030145 - manganese ion binding
GO:0042803 - protein homodimerization activity
GO:0016795 - phosphoric triester hydrolase activity
GO:0070573 - metallodipeptidase activity
GO:0102009 - proline dipeptidase activity
biological_process GO:0006508 - proteolysis
GO:0043171 - peptide catabolic process
External database links:  
DIP:
DIP-10460N
ECOCYC:
EG10698-MONOMER
ECOLIWIKI:
b3847
INTERPRO:
IPR001131
INTERPRO:
IPR036005
INTERPRO:
IPR029149
INTERPRO:
IPR022846
INTERPRO:
IPR000994
MINT:
MINT-1302254
MODBASE:
P21165
PDB:
4QR8
PFAM:
PF00557
PRIDE:
P21165
PROSITE:
PS00491
REFSEQ:
NP_418289
SMR:
P21165
UNIPROT:
P21165


Operon      
Name: pepQ-yigZ-trkH-hemG         
Operon arrangement:
Transcription unit        Promoter
pepQ-yigZ-trkH-hemG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4518 4031130 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4519 4033114 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4520 4034440 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4521 (cluster) 4034445 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB