RegulonDB RegulonDB 10.9: Gene Form
   

pfkB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pfkB ydiY ydiZ anti-anti-terminator anti-terminator terminator terminator yniAp7 yniAp7 TSS_2039 TSS_2039 TSS_2038 TSS_2038 pfkBp1 pfkBp1 pfkBp2 pfkBp2 ydiYp11 ydiYp11 ydiYp6 ydiYp6 ydiYp12 ydiYp12

Gene      
Name: pfkB    Texpresso search in the literature
Synonym(s): ECK1721, EG10700, b1723
Genome position(nucleotides): 1806370 --> 1807299 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.09


Product      
Name: 6-phosphofructokinase 2
Synonym(s): 6-phosphofructokinase II, PfkB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.456
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
12 -> 14 SLD
39 -> 43 GGGIN
90 -> 92 RQN
187 -> 189 NQK
11 -> 296 PSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0003872 - 6-phosphofructokinase activity
GO:0008443 - phosphofructokinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0009024 - tagatose-6-phosphate kinase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006096 - glycolytic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
GO:0061615 - glycolytic process through fructose-6-phosphate
External database links:  
DIP:
DIP-10465N
ECOCYC:
6PFK-2-MONOMER
ECOLIWIKI:
b1723
INTERPRO:
IPR017583
INTERPRO:
IPR011611
INTERPRO:
IPR029056
INTERPRO:
IPR002173
MINT:
P06999
MODBASE:
P06999
PDB:
3UQE
PDB:
3UMO
PDB:
3UMP
PDB:
3UQD
PDB:
3CQD
PDB:
3N1C
PFAM:
PF00294
PRIDE:
P06999
PRODB:
PRO_000023515
PROSITE:
PS00584
PROSITE:
PS00583
REFSEQ:
NP_416237
SMR:
P06999
UNIPROT:
P06999


Operon      
Name: pfkB         
Operon arrangement:
Transcription unit        Promoter
pfkB
pfkB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydiYp12 1806170 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydiYp6 1806217 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydiYp11 1806250 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2038 1807375 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2039 1807377 forward nd [RS-EPT-CBR] [2]
  promoter yniAp7 1807579 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB