RegulonDB RegulonDB 10.9: Gene Form
   

phoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phoR sbcD phoB sbcC PhoB anti-anti-terminator anti-terminator terminator phoBp phoBp sbcDp sbcDp sbcCp2 sbcCp2

Gene      
Name: phoB    Texpresso search in the literature
Synonym(s): ECK0393, EG10728, b0399, phoRc, phoT
Genome position(nucleotides): 417142 --> 417831 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.49
External database links:  
ASAP:
ABE-0001389
CGSC:
397
ECHOBASE:
EB0721
ECOLIHUB:
phoB
OU-MICROARRAY:
b0399
STRING:
511145.b0399
COLOMBOS: phoB


Product      
Name: DNA-binding transcriptional dual regulator PhoB
Synonym(s): PhoB, PhoB response regulator, PhoT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 26.433
Isoelectric point: 5.41
Motif(s):
 
Type Positions Sequence
5 -> 117 ILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIK
151 -> 225 EPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRF
129 -> 227 EEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFST
4 -> 120 RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001108 - bacterial-type RNA polymerase holo enzyme binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:0006817 - phosphate ion transport
GO:2000142 - regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
Reference(s): [1] Heyde M., et al., 1983
[2] Kim SK., et al., 2000
[3] Makino K., et al., 1988
[4] Makino K., et al., 1986
[5] Pao GM., et al., 1995
[6] Parkinson JS. 1993
[7] Parkinson JS., et al., 1992
[8] Pratt C., et al., 1977
[9] Saier MH. 1994
[10] Shinagawa H., et al., 1983
[11] Stock JB., et al., 1990
[12] Zuckier G., et al., 1980
External database links:  
DIP:
DIP-35852N
ECOCYC:
PHOB-MONOMER
ECOLIWIKI:
b0399
INTERPRO:
IPR001867
INTERPRO:
IPR001789
INTERPRO:
IPR011006
INTERPRO:
IPR011879
INTERPRO:
IPR036388
INTERPRO:
IPR039420
MODBASE:
P0AFJ5
PANTHER:
PTHR26402
PDB:
3T72
PDB:
2Z33
PDB:
2JBA
PDB:
2JB9
PDB:
2IYN
PDB:
1ZES
PDB:
1QQI
PDB:
1GXQ
PDB:
1GXP
PDB:
1B00
PFAM:
PF00072
PFAM:
PF00486
PRIDE:
P0AFJ5
PRODB:
PRO_000023541
PROSITE:
PS51755
PROSITE:
PS50110
REFSEQ:
NP_414933
SMART:
SM00448
SMART:
SM00862
SMR:
P0AFJ5
SWISSMODEL:
P0AFJ5
UNIPROT:
P0AFJ5


Operon      
Name: phoBR         
Operon arrangement:
Transcription unit        Promoter
phoBR


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sbcCp2 415847 reverse Similarity to the consensus
Read more >
[ICWHO] [13]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Heyde M., Portalier R., 1983, Isolation and characterization of a new type of Escherichia coli K12 phoB mutants., Mol Gen Genet 190(1):122-7

 [2] Kim SK., Kimura S., Shinagawa H., Nakata A., Lee KS., Wanner BL., Makino K., 2000, Dual transcriptional regulation of the Escherichia coli phosphate-starvation-inducible psiE gene of the phosphate regulon by PhoB and the cyclic AMP (cAMP)-cAMP receptor protein complex., J Bacteriol 182(19):5596-9

 [3] Makino K., Shinagawa H., Amemura M., Kimura S., Nakata A., Ishihama A., 1988, Regulation of the phosphate regulon of Escherichia coli. Activation of pstS transcription by PhoB protein in vitro., J Mol Biol 203(1):85-95

 [4] Makino K., Shinagawa H., Amemura M., Nakata A., 1986, Nucleotide sequence of the phoB gene, the positive regulatory gene for the phosphate regulon of Escherichia coli K-12., J Mol Biol 190(1):37-44

 [5] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [6] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [7] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [8] Pratt C., Torriani A., 1977, Complementation test between alkaline phosphatase regulatory mutations phoB and phoRc in Escherichia coli., Genetics 85(2):203-8

 [9] Saier MH., 1994, Bacterial sensor kinase/response regulator systems: an introduction., Res Microbiol 145(5-6):349-55

 [10] Shinagawa H., Makino K., Nakata A., 1983, Regulation of the pho regulon in Escherichia coli K-12. Genetic and physiological regulation of the positive regulatory gene phoB., J Mol Biol 168(3):477-88

 [11] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [12] Zuckier G., Ingenito E., Torriani A., 1980, Pleiotropic effects of alkaline phosphatase regulatory mutations phoB and phoT on anaerobic growth of and polyphosphate synthesis in Escherichia coli., J Bacteriol 143(2):934-41

 [13] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB