RegulonDB RegulonDB 10.9: Gene Form
   

pinE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mcrA tfaE pinE stfE tfaP mcrAp9 mcrAp9 mcrAp8 mcrAp8 mcrAp10 mcrAp10 mcrAp7 mcrAp7 pinEp3 pinEp3 pinEp1 pinEp1 tfaEp1 tfaEp1 tfaEp6 tfaEp6

Gene      
Name: pinE    Texpresso search in the literature
Synonym(s): ECK1144, EG10737, b1158, pin
Genome position(nucleotides): 1209685 --> 1210239 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.83
External database links:  
ASAP:
ABE-0003888
ECHOBASE:
EB0730
ECOLIHUB:
pinE
OU-MICROARRAY:
b1158
STRING:
511145.b1158
COLOMBOS: pinE


Product      
Name: e14 prophage; site-specific DNA recombinase
Synonym(s): Pin, PinE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.573
Isoelectric point: 10.555
Motif(s):
 
Type Positions Sequence
178 -> 178 R
1 -> 134 MLIGYVRVSTNDQNTDLQRNALNCAGCELIFEDKISGTKSERPGLKKLLRTLSAGDTLVVWKLDRLGRSMRHLVVLVEELRERGINFRSLTDSIDTSTPMGRFFFHVMGALAEMERELIVERTKAGLETARAQG
3 -> 135 IGYVRVSTNDQNTDLQRNALNCAGCELIFEDKISGTKSERPGLKKLLRTLSAGDTLVVWKLDRLGRSMRHLVVLVEELRERGINFRSLTDSIDTSTPMGRFFFHVMGALAEMERELIVERTKAGLETARAQGR
161 -> 180 RQKVAIIYDVGVSTLYKRFP
138 -> 181 GRRPKLTPEQWAQAGRLIAAGTPRQKVAIIYDVGVSTLYKRFPA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0016787 - hydrolase activity
GO:0016874 - ligase activity
GO:0000150 - recombinase activity
biological_process GO:0006310 - DNA recombination
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10737-MONOMER
ECOLIWIKI:
b1158
INTERPRO:
IPR006119
INTERPRO:
IPR036162
INTERPRO:
IPR009057
INTERPRO:
IPR006120
INTERPRO:
IPR006118
MODBASE:
P03014
PFAM:
PF00239
PFAM:
PF02796
PRIDE:
P03014
PRODB:
PRO_000023552
PROSITE:
PS00397
PROSITE:
PS51736
PROSITE:
PS00398
REFSEQ:
NP_415676
SMART:
SM00857
SMR:
P03014
SWISSMODEL:
P03014
UNIPROT:
P03014


Operon      
Name: pinE         
Operon arrangement:
Transcription unit        Promoter
pinE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tfaEp6 1209189 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter tfaEp1 1209266 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pinEp1 1209527 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pinEp3 1209672 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mcrAp7 1210139 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mcrAp10 1210195 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mcrAp8 1210319 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mcrAp9 1210323 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB