RegulonDB RegulonDB 10.9: Gene Form
   

ppiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysS lpxH ppiB cysSp cysSp TSS_678 TSS_678 TSS_677 (cluster) TSS_677 (cluster) TSS_676 TSS_676 TSS_675 TSS_675 TSS_674 (cluster) TSS_674 (cluster)

Gene      
Name: ppiB    Texpresso search in the literature
Synonym(s): ECK0518, EG10758, b0525
Genome position(nucleotides): 553943 <-- 554437 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.88
External database links:  
ASAP:
ABE-0001806
CGSC:
31117
ECHOBASE:
EB0751
ECOLIHUB:
ppiB
OU-MICROARRAY:
b0525
STRING:
511145.b0525
COLOMBOS: ppiB


Product      
Name: peptidyl-prolyl cis-trans isomerase B
Synonym(s): PpiB, rotamase B
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.153
Isoelectric point: 5.588
Motif(s):
 
Type Positions Sequence
1 -> 162 MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGYCVFAEVVDGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTV
132 -> 132 V

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
biological_process GO:0006457 - protein folding
GO:0061077 - chaperone-mediated protein folding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
Reference(s): [1] Guignard L., et al., 2002
[2] Rodriguez-Moya M., et al., 2015
[3] Skagia A., et al., 2017
[4] Yang Y., et al., 2020
External database links:  
DIP:
DIP-10546N
ECOCYC:
EG10758-MONOMER
ECOLIWIKI:
b0525
INTERPRO:
IPR020892
INTERPRO:
IPR002130
INTERPRO:
IPR029000
INTERPRO:
IPR024936
MODBASE:
P23869
PDB:
2NUL
PDB:
2RS4
PDB:
1LOP
PFAM:
PF00160
PRIDE:
P23869
PRINTS:
PR00153
PROSITE:
PS50072
PROSITE:
PS00170
REFSEQ:
NP_415058
SMR:
P23869
UNIPROT:
P23869


Operon      
Name: ppiB-lpxH         
Operon arrangement:
Transcription unit        Promoter
ppiB-lpxH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_674 (cluster) 554360 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_675 554367 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_676 554460 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_677 (cluster) 554490 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_678 554492 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Guignard L., Ozawa K., Pursglove SE., Otting G., Dixon NE., 2002, NMR analysis of in vitro-synthesized proteins without purification: a high-throughput approach., FEBS Lett 524(1-3):159-62

 [2] Rodriguez-Moya M., Gonzalez R., 2015, Proteomic analysis of the response of Escherichia coli to short-chain fatty acids., J Proteomics 122:86-99

 [3] Skagia A., Zografou C., Venieraki A., Fasseas C., Katinakis P., Dimou M., 2017, Functional analysis of the cyclophilin PpiB role in bacterial cell division., Genes Cells 22(9):810-824

 [4] Yang Y., Pan BB., Tan X., Yang F., Liu Y., Su XC., Goldfarb D., 2020, In-Cell Trityl-Trityl Distance Measurements on Proteins., J Phys Chem Lett 11(3):1141-1147

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB