RegulonDB RegulonDB 10.9: Gene Form
   

pykA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pykA lpxM yebK TSS_2208 TSS_2208 TSS_2207 TSS_2207 TSS_2206 TSS_2206 TSS_2205 TSS_2205 TSS_2204 TSS_2204 TSS_2203 TSS_2203 pykAp1 pykAp1 TSS_2201 TSS_2201 pykAp2 pykAp2

Gene      
Name: pykA    Texpresso search in the literature
Synonym(s): ECK1855, EG10803, b1854
Genome position(nucleotides): 1937649 --> 1939091 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.81
External database links:  
ASAP:
ABE-0006182
CGSC:
32363
ECHOBASE:
EB0796
ECOLIHUB:
pykA
OU-MICROARRAY:
b1854
STRING:
511145.b1854
COLOMBOS: pykA


Product      
Name: pyruvate kinase II
Synonym(s): PykA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 51.357
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
38 -> 41 NFSH
6 -> 344 RRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADKVREIAAKLGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPADVVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKADIKTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCSQDAMDDIILASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVITATQMMESMITNPMPTRAEVMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKI
20 -> 20 R
2 -> 480 SRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADKVREIAAKLGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPADVVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKADIKTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCSQDAMDDIILASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVITATQMMESMITNPMPTRAEVMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKIPSINVSKHRLDVQFDNVEEAIAMSAMYAANHLKGVTAIITMTESGRTALMTSRISSGLPIFAMSRHERTLNLTALYRGVTPVHFDSANDGVAAASEAVNLLRDKGYLMSGDLVIVTQGDVMSTVGSTNTTRILTVE
43 -> 43 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:1902912 - pyruvate kinase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004743 - pyruvate kinase activity
GO:0000287 - magnesium ion binding
GO:0016208 - AMP binding
GO:0030955 - potassium ion binding
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0006096 - glycolytic process
GO:0016310 - phosphorylation
External database links:  
DIP:
DIP-10622N
ECOCYC:
PKII-MONOMER
ECOLIWIKI:
b1854
INTERPRO:
IPR011037
INTERPRO:
IPR040442
INTERPRO:
IPR001697
INTERPRO:
IPR036918
INTERPRO:
IPR015793
INTERPRO:
IPR015795
INTERPRO:
IPR015806
INTERPRO:
IPR015813
INTERPRO:
IPR018209
MODBASE:
P21599
PANTHER:
PTHR11817
PFAM:
PF02887
PFAM:
PF00224
PRIDE:
P21599
PRINTS:
PR01050
PRODB:
PRO_000023655
PROSITE:
PS00110
REFSEQ:
NP_416368
SMR:
P21599
UNIPROT:
P21599


Operon      
Name: pykA         
Operon arrangement:
Transcription unit        Promoter
pykA
pykA
pykA
pykA


Regulation by small RNA    
  Display Regulation
small RNA dicF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2201 1937542 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2203 1937547 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2204 1937561 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2205 1937670 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2206 1937972 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2207 1938121 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2208 1938452 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB