RegulonDB RegulonDB 10.10: Gene Form
   

recO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

era pdxJ recO rnc TSS_2857 TSS_2857 TSS_2856 TSS_2856 pdxJp pdxJp acpSp3 acpSp3 acpSp2 acpSp2

Gene      
Name: recO    Texpresso search in the literature
Synonym(s): ECK2563, EG10832, b2565
Genome position(nucleotides): 2701741 <-- 2702469 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.05
External database links:  
ASAP:
ABE-0008438
CGSC:
17962
ECHOBASE:
EB0825
ECOLIHUB:
recO
OU-MICROARRAY:
b2565
STRING:
511145.b2565
COLOMBOS: recO


Product      
Name: DNA repair protein RecO
Synonym(s): RecO
Sequence: Get amino acid sequence Fasta Format
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 27.391
Isoelectric point: 10.233
Motif(s):
 
Type Positions Sequence
83 -> 226 GITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRE
4 -> 76 WQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0043590 - bacterial nucleoid
molecular_function GO:0005515 - protein binding
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009314 - response to radiation
GO:0006302 - double-strand break repair
Reference(s): [1] Bork JM., et al., 2001
[2] Hegde S., et al., 1995
[3] Kolodner R., et al., 1985
[4] Luisi-DeLuca C. 1995
[5] Luisi-DeLuca C., et al., 1994
[6] Shan Q., et al., 1997
External database links:  
DIP:
DIP-48093N
ECOCYC:
EG10832-MONOMER
ECOLIWIKI:
b2565
INTERPRO:
IPR003717
INTERPRO:
IPR012340
INTERPRO:
IPR022572
INTERPRO:
IPR037278
PANTHER:
PTHR33991
PDB:
3Q8D
PFAM:
PF02565
PFAM:
PF11967
PRIDE:
P0A7H3
PRODB:
PRO_000023705
REFSEQ:
NP_417060
SMR:
P0A7H3
UNIPROT:
P0A7H3


Operon      
Name: rnc-era-recO-pdxJ-acpS         
Operon arrangement:
Transcription unit        Promoter
pdxJ-acpS
rnc-era
rnc-era-recO-pdxJ-acpS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter acpSp2 2701137 reverse nd [ICWHO] [7]
  promoter acpSp3 2701162 reverse nd [ICWHO] [7]
  promoter TSS_2856 2702292 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2857 2702302 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bork JM., Cox MM., Inman RB., 2001, The RecOR proteins modulate RecA protein function at 5' ends of single-stranded DNA., EMBO J 20(24):7313-22

 [2] Hegde S., Sandler SJ., Clark AJ., Madiraju MV., 1995, recO and recR mutations delay induction of the SOS response in Escherichia coli., Mol Gen Genet 246(2):254-8

 [3] Kolodner R., Fishel RA., Howard M., 1985, Genetic recombination of bacterial plasmid DNA: effect of RecF pathway mutations on plasmid recombination in Escherichia coli., J Bacteriol 163(3):1060-6

 [4] Luisi-DeLuca C., 1995, Homologous pairing of single-stranded DNA and superhelical double-stranded DNA catalyzed by RecO protein from Escherichia coli., J Bacteriol 177(3):566-72

 [5] Luisi-DeLuca C., Kolodner R., 1994, Purification and characterization of the Escherichia coli RecO protein. Renaturation of complementary single-stranded DNA molecules catalyzed by the RecO protein., J Mol Biol 236(1):124-38

 [6] Shan Q., Bork JM., Webb BL., Inman RB., Cox MM., 1997, RecA protein filaments: end-dependent dissociation from ssDNA and stabilization by RecO and RecR proteins., J Mol Biol 265(5):519-40

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB