RegulonDB RegulonDB 11.1: Gene Form

rplB gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

rplB rplW rpsS rplD TSS_3811 (cluster) TSS_3811 (cluster) TSS_3810 TSS_3810 TSS_3809 (cluster) TSS_3809 (cluster) TSS_3808 TSS_3808 TSS_3807 (cluster) TSS_3807 (cluster) TSS_3806 TSS_3806 TSS_3805 TSS_3805 TSS_3804 TSS_3804 TSS_3803 TSS_3803 TSS_3802 TSS_3802 TSS_3801 TSS_3801 TSS_3800 (cluster) TSS_3800 (cluster)

Name: rplB    Texpresso search in the literature
Synonym(s): ECK3304, EG10865, b3317
Genome position(nucleotides): 3450543 <-- 3451364
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: 50S ribosomal subunit protein L2
Synonym(s): RplB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,ribosome
Molecular weight: 29.86
Isoelectric point: 11.55
Type Positions Sequence Comment
28 -> 53 KPFAPLLEKNSKSGGRNNNGRITTRH UniProt: Disordered; Sequence Annotation Type: region of interest.
221 -> 273 RGTAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSK UniProt: Disordered; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:1990082 - DnaA-L2 complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015934 - large ribosomal subunit
GO:0022625 - cytosolic large ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0019843 - rRNA binding
GO:0008270 - zinc ion binding
biological_process GO:0006412 - translation
GO:0000027 - ribosomal large subunit assembly
GO:0032297 - negative regulation of DNA-templated DNA replication initiation
GO:0002181 - cytoplasmic translation
Note(s): Note(s): ...[more].
External database links:  

Name: rpsJ-rplCDWB-rpsS-rplV-rpsC-rplP-rpmC-rpsQ         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: ArcA

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3800 (cluster) 3450252 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3801 3450347 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3802 3450357 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3803 3450389 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3804 3450425 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3805 3450474 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3806 3450533 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3807 (cluster) 3450543 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3808 3451410 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3809 (cluster) 3451437 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3810 3451529 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3811 (cluster) 3451535 reverse nd [RS-EPT-CBR] [1]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
