RegulonDB RegulonDB 11.1: Gene Form
   

rplJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rplA rplJ rplL DksA-ppGpp DksA-ppGpp terminator anti-terminator anti-anti-terminator TSS_4763 TSS_4763 TSS_4762 TSS_4762 TSS_4761 (cluster) TSS_4761 (cluster) TSS_4760 (cluster) TSS_4760 (cluster) TSS_4759 TSS_4759 TSS_4758 TSS_4758 TSS_4757 (cluster) TSS_4757 (cluster) TSS_4756 (cluster) TSS_4756 (cluster) TSS_4755 TSS_4755 TSS_4754 (cluster) TSS_4754 (cluster) TSS_4753 TSS_4753 TSS_4752 TSS_4752 TSS_4751 TSS_4751 TSS_4750 TSS_4750 TSS_4749 TSS_4749 TSS_4748 (cluster) TSS_4748 (cluster) rplJp rplJp TSS_4747 TSS_4747 TSS_4746 TSS_4746 TSS_4745 TSS_4745 TSS_4744 TSS_4744 TSS_4743 (cluster) TSS_4743 (cluster) TSS_4742 (cluster) TSS_4742 (cluster) TSS_4741 TSS_4741 TSS_4740 TSS_4740

Gene      
Name: rplJ    Texpresso search in the literature
Synonym(s): ECK3976, EG10871, b3985
Genome position(nucleotides): 4179996 --> 4180493
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.41
External database links:  
ASAP:
ABE-0013035
CGSC:
256
ECHOBASE:
EB0864
ECOLIHUB:
rplJ
OU-MICROARRAY:
b3985
STRING:
511145.b3985
COLOMBOS: rplJ


Product      
Name: 50S ribosomal subunit protein L10
Synonym(s): RplJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,ribosome
Molecular weight: 17.712
Isoelectric point: 9.502
Motif(s):
 
Type Positions Sequence Comment
2 -> 165 ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA UniProt: 50S ribosomal protein L10.
5 -> 101 LQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAK
84 -> 84 Y UniProt: In Ref. 5; AA sequence, 6; AA sequence and 7; AA sequence..
116 -> 116 E UniProt: In Ref. 5; AA sequence..
156 -> 165 AAVRDAKEAA UniProt: Generation time doubles, only 1 L12 dimer binds to the ribosome. Decreased association of IF-2 with L7/L12 and decreased stimulation of GTPase activity of EF-G by L7/L12..

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015934 - large ribosomal subunit
GO:0022625 - cytosolic large ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0005515 - protein binding
GO:0043022 - ribosome binding
GO:0003723 - RNA binding
GO:0003924 - GTPase activity
GO:0019843 - rRNA binding
GO:0070180 - large ribosomal subunit rRNA binding
biological_process GO:0006412 - translation
GO:0006417 - regulation of translation
GO:0017148 - negative regulation of translation
GO:0002181 - cytoplasmic translation
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0A7J3
DIP:
DIP-35816N
ECOCYC:
EG10871-MONOMER
ECOLIWIKI:
b3985
INTERPRO:
IPR043141
INTERPRO:
IPR001790
INTERPRO:
IPR002363
INTERPRO:
IPR022973
PANTHER:
PTHR11560
PDB:
3J7Z
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JCJ
PDB:
4UY8
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6V
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V85
PDB:
4V89
PDB:
4V9O
PDB:
4V9P
PDB:
4YBB
PDB:
5ADY
PDB:
5AFI
PDB:
5GAD
PDB:
5GAE
PDB:
5GAF
PDB:
5GAG
PDB:
5GAH
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5NCO
PDB:
5NP6
PDB:
5O2R
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6HRM
PDB:
6I0Y
PDB:
6O9K
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PDB:
6WD6
PDB:
6WDB
PDB:
6WDC
PDB:
6WDD
PDB:
6WDE
PDB:
6WDF
PDB:
6WDG
PDB:
6WDH
PDB:
6WDI
PDB:
6WDJ
PDB:
6WDK
PDB:
6WDL
PDB:
6WDM
PDB:
6WNT
PDB:
6WNV
PDB:
6WNW
PDB:
6XZ7
PDB:
6XZA
PDB:
6XZB
PDB:
7BV8
PDB:
7JSZ
PDB:
7JT2
PDB:
7JT3
PFAM:
PF00466
PRIDE:
P0A7J3
PRODB:
PRO_000023816
PROSITE:
PS01109
REFSEQ:
NP_418412
SMR:
P0A7J3
UNIPROT:
P0A7J3


Operon      
Name: rplKAJL-rpoBC         
Operon arrangement:
Transcription unit        Promoter
rplKAJL-rpoBC
rplJL-rpoBC
rpoBC
rplL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4740 4178909 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4741 4178984 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4742 (cluster) 4178989 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4743 (cluster) 4179096 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4744 4179207 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4745 4179294 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4746 4179300 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4747 4179401 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4748 (cluster) 4179779 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4749 4180008 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4750 4180015 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4751 4180019 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4752 4180450 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4753 4180456 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4754 (cluster) 4180531 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4755 4180535 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4756 (cluster) 4180541 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4757 (cluster) 4180555 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4758 4180562 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4759 4180564 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4760 (cluster) 4180570 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4761 (cluster) 4180576 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4762 4180581 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4763 4180584 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB