RegulonDB RegulonDB 11.0: Gene Form
   

rplK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rplA nusG rplK  OxyS DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp terminator anti-terminator anti-anti-terminator TSS_4747 TSS_4747 TSS_4746 TSS_4746 TSS_4745 TSS_4745 TSS_4744 TSS_4744 TSS_4743 (cluster) TSS_4743 (cluster) TSS_4742 (cluster) TSS_4742 (cluster) TSS_4741 TSS_4741 TSS_4740 TSS_4740 TSS_4739 TSS_4739 TSS_4738 TSS_4738 TSS_4737 (cluster) TSS_4737 (cluster) rplKp rplKp

Gene      
Name: rplK    Texpresso search in the literature
Synonym(s): ECK3974, EG10872, b3983, relC
Genome position(nucleotides): 4178447 --> 4178875
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.21
External database links:  
ASAP:
ABE-0013029
CGSC:
255
ECHOBASE:
EB0865
ECOLIHUB:
rplK
OU-MICROARRAY:
b3983
STRING:
511145.b3983
COLOMBOS: rplK


Product      
Name: 50S ribosomal subunit protein L11
Synonym(s): RelC, RplK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,ribosome
Molecular weight: 14.875
Isoelectric point: 10.321
Motif(s):
 
Type Positions Sequence Comment
2 -> 142 AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED UniProt: 50S ribosomal protein L11.
9 -> 67 VKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSF
72 -> 140 KTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVV
132 -> 132 T UniProt: In Ref. 1; CAA23621..

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015934 - large ribosomal subunit
GO:0022625 - cytosolic large ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0019843 - rRNA binding
GO:0070180 - large ribosomal subunit rRNA binding
biological_process GO:0006412 - translation
GO:0000027 - ribosomal large subunit assembly
GO:0006415 - translational termination
GO:0015968 - stringent response
GO:0002181 - cytoplasmic translation
Note(s): Note(s): ...[more].
Reference(s): [1] Alix JH., et al., 1974
[2] Alix JH., et al., 1974
[3] Chang FN., et al., 1974
[4] Dlugosz M., et al., 2011
[5] Huang Y., et al., 2010
[6] Li W., et al., 2006
[7] Liu W., et al., 2014
External database links:  
ALPHAFOLD:
P0A7J7
DIP:
DIP-35882N
ECOCYC:
EG10872-MONOMER
ECOLIWIKI:
b3983
INTERPRO:
IPR000911
INTERPRO:
IPR036769
INTERPRO:
IPR036796
INTERPRO:
IPR006519
INTERPRO:
IPR020783
INTERPRO:
IPR020784
INTERPRO:
IPR020785
MODBASE:
P0A7J7
PANTHER:
PTHR11661
PDB:
1EG0
PDB:
1MJ1
PDB:
1ML5
PDB:
2J28
PDB:
2RDO
PDB:
3DEG
PDB:
3EP2
PDB:
3EQ3
PDB:
3EQ4
PDB:
3J0D
PDB:
3J5L
PDB:
3J7Z
PDB:
3J8G
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
487D
PDB:
4CSU
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4UY8
PDB:
4V47
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5ADY
PDB:
5AFI
PDB:
5AKA
PDB:
5GAD
PDB:
5GAE
PDB:
5GAF
PDB:
5GAG
PDB:
5GAH
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5NCO
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6HRM
PDB:
6I0Y
PDB:
6I7V
PDB:
6O9J
PDB:
6O9K
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PDB:
6S0K
PDB:
6WD6
PDB:
6WDB
PDB:
6WDC
PDB:
6WDD
PDB:
6WDE
PDB:
6WDF
PDB:
6WDG
PDB:
6WDH
PDB:
6WDI
PDB:
6WDJ
PDB:
6WDK
PDB:
6WDL
PDB:
6WDM
PDB:
6WNT
PDB:
6WNV
PDB:
6WNW
PDB:
6XZ7
PDB:
6XZA
PDB:
6XZB
PDB:
6YSR
PDB:
6YSS
PDB:
6YST
PDB:
6YSU
PDB:
6ZTJ
PDB:
7BV8
PDB:
7JSZ
PDB:
7JT3
PFAM:
PF03946
PFAM:
PF00298
PRIDE:
P0A7J7
PRODB:
PRO_000023817
PROSITE:
PS00359
REFSEQ:
NP_418410
SMART:
SM00649
SMR:
P0A7J7
UNIPROT:
P0A7J7


Operon      
Name: rplKAJL-rpoBC         
Operon arrangement:
Transcription unit        Promoter
rplKAJL-rpoBC
rplJL-rpoBC
rpoBC
rplL


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4737 (cluster) 4178391 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4738 4178440 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4739 4178780 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4740 4178909 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4741 4178984 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4742 (cluster) 4178989 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4743 (cluster) 4179096 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4744 4179207 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4745 4179294 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4746 4179300 forward nd [RS-EPT-CBR] [8]
  promoter TSS_4747 4179401 forward nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Alix JH., Hayes D., 1974, [Detection of N-epsilon, N-epsilon, N-epsilon-trimethyllysine in ribosomal protein L 11 by methylation of E. coli ribosomes synthesized in the presence of ethionine]., C R Acad Hebd Seances Acad Sci D 278(7):951-3

 [2] Alix JH., Hayes D., 1974, Properties of ribosomes and RNA synthesized by Escherichia coli grown in the presence of ethionine. 3. Methylated proteins in 50 S ribosomes of E. coli EA2., J Mol Biol 86(1):139-59

 [3] Chang FN., Chang CN., Paik WK., 1974, Methylation of ribosomal proteins in Escherichia coli., J Bacteriol 120(2):651-6

 [4] Dlugosz M., Huber GA., McCammon JA., Trylska J., 2011, Brownian dynamics study of the association between the 70S ribosome and elongation factor G., Biopolymers 95(9):616-27

 [5] Huang Y., Russell WK., Wan W., Pai PJ., Russell DH., Liu W., 2010, A convenient method for genetic incorporation of multiple noncanonical amino acids into one protein in Escherichia coli., Mol Biosyst 6(4):683-6

 [6] Li W., Sengupta J., Rath BK., Frank J., 2006, Functional conformations of the L11-ribosomal RNA complex revealed by correlative analysis of cryo-EM and molecular dynamics simulations., RNA 12(7):1240-53

 [7] Liu W., Kavaliauskas D., Schrader JM., Poruri K., Birkedal V., Goldman E., Jakubowski H., Mandecki W., Uhlenbeck OC., Knudsen CR., Goldman YE., Cooperman BS., 2014, Labeled EF-Tus for rapid kinetic studies of pretranslocation complex formation., ACS Chem Biol 9(10):2421-31

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB