RegulonDB RegulonDB 10.9: Gene Form
   

rpsH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rplF rpsH rpsN TSS_3766 TSS_3766 TSS_3765 TSS_3765 TSS_3764 TSS_3764 TSS_3763 TSS_3763 TSS_3762 (cluster) TSS_3762 (cluster) TSS_3761 (cluster) TSS_3761 (cluster) TSS_3760 (cluster) TSS_3760 (cluster) TSS_3759 (cluster) TSS_3759 (cluster) TSS_3758 TSS_3758 TSS_3757 TSS_3757 TSS_3756 TSS_3756 TSS_3755 (cluster) TSS_3755 (cluster) TSS_3754 (cluster) TSS_3754 (cluster) TSS_3753 TSS_3753 TSS_3752 TSS_3752 TSS_3751 TSS_3751 TSS_3750 TSS_3750 TSS_3749 (cluster) TSS_3749 (cluster) TSS_3748 TSS_3748 TSS_3747 TSS_3747 TSS_3746 TSS_3746 TSS_3745 TSS_3745 TSS_3744 (cluster) TSS_3744 (cluster) TSS_3743 (cluster) TSS_3743 (cluster) TSS_3742 (cluster) TSS_3742 (cluster) TSS_3741 TSS_3741 TSS_3740 TSS_3740 TSS_3739 TSS_3739

Gene      
Name: rpsH    Texpresso search in the literature
Synonym(s): ECK3293, EG10907, b3306
Genome position(nucleotides): 3446153 <-- 3446545 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.13
External database links:  
ASAP:
ABE-0010829
CGSC:
223
ECHOBASE:
EB0900
ECOLIHUB:
rpsH
OU-MICROARRAY:
b3306
STRING:
511145.b3306
COLOMBOS: rpsH


Product      
Name: 30S ribosomal subunit protein S8
Synonym(s): RpsH
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 14.127
Isoelectric point: 10.014
Motif(s):
 
Type Positions Sequence
5 -> 129 DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYV
91 -> 91 E
2 -> 130 SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0003723 - RNA binding
GO:0019843 - rRNA binding
biological_process GO:0006412 - translation
GO:0006417 - regulation of translation
GO:0043488 - regulation of mRNA stability
GO:0000028 - ribosomal small subunit assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Lux B., et al., 1977
[2] Muller R., et al., 1979
[3] Osterberg R., et al., 1978
External database links:  
DIP:
DIP-47901N
ECOCYC:
EG10907-MONOMER
ECOLIWIKI:
b3306
INTERPRO:
IPR000630
INTERPRO:
IPR035987
MODBASE:
P0A7W7
PANTHER:
PTHR11758
PDB:
1EG0
PDB:
1M5G
PDB:
1S03
PDB:
2YKR
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBU
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
4A2I
PDB:
4ADV
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4V47
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5AFI
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5ME0
PDB:
5ME1
PDB:
5MGP
PDB:
5MY1
PDB:
5NO2
PDB:
5NO3
PDB:
5NO4
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6I7V
PDB:
6O9J
PDB:
6O9K
PDB:
6OFX
PDB:
6OG7
PDB:
6ORE
PDB:
6ORL
PDB:
6OST
PDB:
6OT3
PDB:
6OUO
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PDB:
6SZS
PDB:
6TBV
PDB:
6TC3
PFAM:
PF00410
PRIDE:
P0A7W7
PRODB:
PRO_000023861
PROSITE:
PS00053
REFSEQ:
NP_417765
SMR:
P0A7W7
UNIPROT:
P0A7W7


Operon      
Name: rplNXE-rpsNH-rplFR-rpsE-rpmD-rplO-secY-rpmJ         
Operon arrangement:
Transcription unit        Promoter
rplNXE-rpsNH-rplFR-rpsE-rpmD-rplO-secY-rpmJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3739 3445611 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3740 3445620 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3741 3445623 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3742 (cluster) 3445658 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3743 (cluster) 3445685 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3744 (cluster) 3445691 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3745 3445699 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3746 3445701 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3747 3445710 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3748 3445872 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3749 (cluster) 3446058 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3750 3446394 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3751 3446402 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3752 3446641 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3753 3446790 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3754 (cluster) 3446794 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3755 (cluster) 3446797 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3756 3446801 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3757 3446807 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3758 3446812 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3759 (cluster) 3446829 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3760 (cluster) 3446832 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3761 (cluster) 3446837 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3762 (cluster) 3446840 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3763 3446845 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3764 3446851 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3765 3446872 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3766 3446880 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lux B., Gerard D., Laustriat G., 1977, Tyrosine fluorescence of S8 and S15 Escherichia coli ribosomal proteins., FEBS Lett 80(1):66-70

 [2] Muller R., Garrett RA., Noller HF., 1979, The structure of the RNA binding site of ribosomal proteins S8 and S15., J Biol Chem 254(10):3873-8

 [3] Osterberg R., Sjoberg B., 1978, Small-angle X-ray scattering study of the proteins S1, S8, S15, S16, S20 from Escherichia coli ribosomes., FEBS Lett 93(1):115-9

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB