RegulonDB RegulonDB 10.9: Gene Form
   

rpsL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpsG rpsL tusB DksA-ppGpp DksA-ppGpp anti-anti-terminator anti-terminator terminator TSS_3943 TSS_3943 TSS_3942 TSS_3942 rpsLp rpsLp TSS_3941 TSS_3941 TSS_3940 (cluster) TSS_3940 (cluster) TSS_3939 TSS_3939 TSS_3938 TSS_3938 TSS_3937 (cluster) TSS_3937 (cluster) TSS_3936 (cluster) TSS_3936 (cluster) TSS_3935 TSS_3935 TSS_3934 TSS_3934 TSS_3933 TSS_3933 TSS_3932 TSS_3932 TSS_3931 TSS_3931 TSS_3930 TSS_3930 TSS_3929 TSS_3929 TSS_3928 TSS_3928 TSS_3927 TSS_3927 TSS_3926 TSS_3926 TSS_3925 TSS_3925 TSS_3924 TSS_3924 TSS_3923 TSS_3923 TSS_3922 (cluster) TSS_3922 (cluster) TSS_3921 TSS_3921 TSS_3920 TSS_3920 TSS_3919 TSS_3919 TSS_3918 TSS_3918 TSS_3917 TSS_3917 TSS_3916 TSS_3916 TSS_3915 (cluster) TSS_3915 (cluster) TSS_3914 TSS_3914 TSS_3913 TSS_3913 TSS_3912 TSS_3912 TSS_3911 TSS_3911 TSS_3910 TSS_3910 TSS_3909 TSS_3909 TSS_3908 TSS_3908 fusAp fusAp TSS_3907 TSS_3907

Gene      
Name: rpsL    Texpresso search in the literature
Synonym(s): ECK3329, EG10911, asuB, b3342, strA
Genome position(nucleotides): 3474178 <-- 3474552 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
External database links:  
ASAP:
ABE-0010919
CGSC:
220
ECHOBASE:
EB0904
ECOLIHUB:
rpsL
OU-MICROARRAY:
b3342
STRING:
511145.b3342
COLOMBOS: rpsL


Product      
Name: 30S ribosomal subunit protein S12
Synonym(s): AsuB, RpsL, StrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 13.737
Isoelectric point: 11.491
Motif(s):
 
Type Positions Sequence
12 -> 123 RARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK
88 -> 88 K
43 -> 43 K
57 -> 57 L
2 -> 124 ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015935 - small ribosomal subunit
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0000049 - tRNA binding
GO:0019843 - rRNA binding
GO:0034336 - misfolded RNA binding
biological_process GO:0006412 - translation
GO:0046677 - response to antibiotic
GO:0000372 - Group I intron splicing
GO:0033120 - positive regulation of RNA splicing
GO:0034337 - RNA folding
GO:1990145 - maintenance of translational fidelity
Note(s): Note(s): ...[more].
Reference(s): [1] Agirrezabala X., et al., 2011
[2] Benitez-Paez A., et al., 2014
[3] Bulkley D., et al., 2014
[4] Fontecave M., et al., 2008
[5] Kaberdina AC., et al., 2009
[6] Liang W., et al., 2013
[7] Lin J., et al., 2015
[8] Llano-Sotelo B., et al., 2009
[9] Meng J., et al., 2012
[10] Pai RD., et al., 2008
[11] Pelchovich G., et al., 2014
[12] Pelchovich G., et al., 2013
[13] Siller E., et al., 2010
[14] Soung GY., et al., 2009
[15] Sun Q., et al., 2011
[16] Yokoyama T., et al., 2012
External database links:  
DIP:
DIP-35806N
DISPROT:
DP00145
ECOCYC:
EG10911-MONOMER
ECOLIWIKI:
b3342
INTERPRO:
IPR012340
INTERPRO:
IPR005679
INTERPRO:
IPR006032
PANTHER:
PTHR11652
PDB:
1M5G
PDB:
1MJ1
PDB:
1ZN1
PDB:
2YKR
PDB:
3DEG
PDB:
3EP2
PDB:
3EQ3
PDB:
3EQ4
PDB:
3J0D
PDB:
3J0E
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBU
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
4A2I
PDB:
4ADV
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4V47
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5AFI
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5ME0
PDB:
5ME1
PDB:
5MGP
PDB:
5MY1
PDB:
5NO2
PDB:
5NO3
PDB:
5NO4
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U4J
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6I7V
PDB:
6O9J
PDB:
6O9K
PDB:
6OFX
PDB:
6OG7
PDB:
6ORE
PDB:
6ORL
PDB:
6OST
PDB:
6OT3
PDB:
6OUO
PDB:
6Q9A
PDB:
6SZS
PDB:
6TBV
PDB:
6TC3
PFAM:
PF00164
PRIDE:
P0A7S3
PRINTS:
PR01034
PRODB:
PRO_000023865
PROSITE:
PS00055
REFSEQ:
NP_417801
SMR:
P0A7S3
UNIPROT:
P0A7S3


Operon      
Name: rpsLG-fusA-tufA         
Operon arrangement:
Transcription unit        Promoter
tufA
tufA
fusA-tufA
rpsLG-fusA-tufA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3907 3473631 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3908 3473774 forward nd [RS-EPT-CBR] [17]
  promoter TSS_3909 3473810 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3910 3473812 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3911 3473899 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3912 3473903 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3913 3473914 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3914 3473953 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3915 (cluster) 3473958 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [17]
  promoter TSS_3916 3473962 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3917 3473997 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3918 3473999 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3919 3474004 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3920 3474070 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3921 3474079 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3922 (cluster) 3474082 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [17]
  promoter TSS_3923 3474101 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3924 3474116 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3925 3474135 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3926 3474139 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3927 3474141 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3928 3474149 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3929 3474182 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3930 3474189 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3931 3474191 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3932 3474204 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3933 3474209 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3934 3474211 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3935 3474528 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3936 (cluster) 3474542 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [17]
  promoter TSS_3937 (cluster) 3474557 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [17]
  promoter TSS_3938 3474571 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3939 3474580 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3940 (cluster) 3474595 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [17]
  promoter TSS_3941 3474598 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3942 3474628 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_3943 3474800 reverse nd [RS-EPT-CBR] [17]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Agirrezabala X., Schreiner E., Trabuco LG., Lei J., Ortiz-Meoz RF., Schulten K., Green R., Frank J., 2011, Structural insights into cognate versus near-cognate discrimination during decoding., EMBO J 30(8):1497-507

 [2] Benitez-Paez A., Cardenas-Brito S., Corredor M., Villarroya M., Armengod ME., 2014, Impairing methylations at ribosome RNA, a point mutation-dependent strategy for aminoglycoside resistance: the rsmG case., Biomedica 34 Suppl 1:41-9

 [3] Bulkley D., Brandi L., Polikanov YS., Fabbretti A., O'Connor M., Gualerzi CO., Steitz TA., 2014, The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation., Cell Rep 6(2):357-65

 [4] Fontecave M., Mulliez E., Atta M., 2008, New light on methylthiolation reactions., Chem Biol 15(3):209-10

 [5] Kaberdina AC., Szaflarski W., Nierhaus KH., Moll I., 2009, An unexpected type of ribosomes induced by kasugamycin: a look into ancestral times of protein synthesis?, Mol Cell 33(2):227-36

 [6] Liang W., Deutscher MP., 2013, Ribosomes regulate the stability and action of the exoribonuclease RNase R., J Biol Chem 288(48):34791-8

 [7] Lin J., Gagnon MG., Bulkley D., Steitz TA., 2015, Conformational changes of elongation factor G on the ribosome during tRNA translocation., Cell 160(1-2):219-27

 [8] Llano-Sotelo B., Hickerson RP., Lancaster L., Noller HF., Mankin AS., 2009, Fluorescently labeled ribosomes as a tool for analyzing antibiotic binding., RNA 15(8):1597-604

 [9] Meng J., Kanzaki G., Meas D., Lam CK., Crummer H., Tain J., Xu HH., 2012, A genome-wide inducible phenotypic screen identifies antisense RNA constructs silencing Escherichia coli essential genes., FEMS Microbiol Lett 329(1):45-53

 [10] Pai RD., Zhang W., Schuwirth BS., Hirokawa G., Kaji H., Kaji A., Cate JH., 2008, Structural Insights into ribosome recycling factor interactions with the 70S ribosome., J Mol Biol 376(5):1334-47

 [11] Pelchovich G., Nadejda S., Dana A., Tuller T., Bravo IG., Gophna U., 2014, Ribosomal mutations affecting the translation of genes that use non-optimal codons., FEBS J 281(16):3701-18

 [12] Pelchovich G., Schreiber R., Zhuravlev A., Gophna U., 2013, The contribution of common rpsL mutations in Escherichia coli to sensitivity to ribosome targeting antibiotics., Int J Med Microbiol 303(8):558-62

 [13] Siller E., DeZwaan DC., Anderson JF., Freeman BC., Barral JM., 2010, Slowing bacterial translation speed enhances eukaryotic protein folding efficiency., J Mol Biol 396(5):1310-8

 [14] Soung GY., Miller JL., Koc H., Koc EC., 2009, Comprehensive analysis of phosphorylated proteins of Escherichia coli ribosomes., J Proteome Res 8(7):3390-402

 [15] Sun Q., Vila-Sanjurjo A., O'Connor M., 2011, Mutations in the intersubunit bridge regions of 16S rRNA affect decoding and subunit-subunit interactions on the 70S ribosome., Nucleic Acids Res 39(8):3321-30

 [16] Yokoyama T., Shaikh TR., Iwakura N., Kaji H., Kaji A., Agrawal RK., 2012, Structural insights into initial and intermediate steps of the ribosome-recycling process., EMBO J 31(7):1836-46

 [17] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB