RegulonDB RegulonDB 10.8: Gene Form
   

coaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

birA coaA unknown thrU murB Fis Fis Fis ppGpp thrUp thrUp TSS_4701 TSS_4701 TSS_4700 TSS_4700 coaAp coaAp

Gene      
Name: coaA    Texpresso search in the literature
Synonym(s): ECK3966, EG10922, b3974, panK, rts, ts-9
Genome position(nucleotides): 4174076 <-- 4175026 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.06
External database links:  
ASAP:
ABE-0013003
CGSC:
17731
ECHOBASE:
EB0915
OU-MICROARRAY:
b3974
PortEco:
coaA
STRING:
511145.b3974
COLOMBOS: coaA


Product      
Name: pantothenate kinase
Synonym(s): CoaA, PanK, Rts, type I pantothenate kinase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.36
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
90 -> 244 IISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRF
95 -> 102 GSVAVGKS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.5 - Coenzyme A and its modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0050165 - pantetheine kinase activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004594 - pantothenate kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0015937 - coenzyme A biosynthetic process
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Balibar CJ., et al., 2011
[2] Gao M., et al., 2012
[3] Rothmann M., et al., 2013
[4] Spry C., et al., 2014
External database links:  
ECOCYC:
PANTOTHENATE-KIN-MONOMER
ECOLIWIKI:
b3974
INTERPRO:
IPR027417
INTERPRO:
IPR006083
INTERPRO:
IPR004566
MODBASE:
P0A6I3
PANTHER:
PTHR10285:SF139
PDB:
1ESN
PDB:
1ESM
PDB:
1SQ5
PFAM:
PF00485
PRIDE:
P0A6I3
PRODB:
PRO_000022308
REFSEQ:
NP_418405
SMR:
P0A6I3
UNIPROT:
P0A6I3


Operon      
Name: coaA         
Operon arrangement:
Transcription unit        Promoter
coaA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4700 4175254 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4701 4175278 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Balibar CJ., Hollis-Symynkywicz MF., Tao J., 2011, Pantethine rescues phosphopantothenoylcysteine synthetase and phosphopantothenoylcysteine decarboxylase deficiency in Escherichia coli but not in Pseudomonas aeruginosa., J Bacteriol 193(13):3304-12

 [2] Gao M., An T., Li G., Nie X., Yip HY., Zhao H., Wong PK., 2012, Genetic studies of the role of fatty acid and coenzyme A in photocatalytic inactivation of Escherichia coli., Water Res 46(13):3951-7

 [3] Rothmann M., Kang M., Villa R., Ntai I., La Clair JJ., Kelleher NL., Chapman E., Burkart MD., 2013, Metabolic perturbation of an essential pathway: evaluation of a glycine precursor of coenzyme A., J Am Chem Soc 135(16):5962-5

 [4] Spry C., Saliba KJ., Strauss E., 2014, A miniaturized assay for measuring small molecule phosphorylation in the presence of complex matrices., Anal Biochem 451:76-8

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB