RegulonDB RegulonDB 10.8: Gene Form
   

sfsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sfsA thpR dksA CRP DksA DksA-ppGpp DksA-ppGpp ppGpp TSS_286 TSS_286 sfsAp sfsAp TSS_285 TSS_285 TSS_284 (cluster) TSS_284 (cluster) TSS_283 TSS_283 TSS_282 TSS_282 TSS_281 (cluster) TSS_281 (cluster) TSS_280 TSS_280 TSS_279 TSS_279 TSS_278 TSS_278 TSS_277 (cluster) TSS_277 (cluster) dksAp3 dksAp3 dksAp1 dksAp1 dksAp2 dksAp2 TSS_275 (cluster) TSS_275 (cluster) TSS_274 TSS_274

Gene      
Name: sfsA    Texpresso search in the literature
Synonym(s): ECK0145, EG10949, b0146, sfs, sfs1
Genome position(nucleotides): 160782 <-- 161486 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.36
External database links:  
ASAP:
ABE-0000503
CGSC:
30524
ECHOBASE:
EB0942
OU-MICROARRAY:
b0146
PortEco:
sfsA
STRING:
511145.b0146
COLOMBOS: sfsA


Product      
Name: putative DNA-binding transcriptional regulator of maltose metabolism
Synonym(s): Sfs, SfsA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.229
Isoelectric point: 7.029
Motif(s):
 
Type Positions Sequence
13 -> 80 IQRYKRFLADVITPDGRELTLHCPNTGAMTGCATPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICV
201 -> 220 LLSEAQQRGVEILAYKAEIS
85 -> 222 ANRLTKEAILNESISELSGYSSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRELMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Kawamukai M., et al., 1991
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-48084N
ECOCYC:
EG10949-MONOMER
ECOLIWIKI:
b0146
INTERPRO:
IPR040452
INTERPRO:
IPR041465
INTERPRO:
IPR005224
MINT:
MINT-1271616
PANTHER:
PTHR30545
PDB:
4DAP
PFAM:
PF17746
PFAM:
PF03749
PRIDE:
P0A823
PRODB:
PRO_000023941
REFSEQ:
NP_414688
SMR:
P0A823
UNIPROT:
P0A823


Operon      
Name: sfsA-dksA-gluQ         
Operon arrangement:
Transcription unit        Promoter
dksA-yadB
dksA-yadB
dksA-gluQ
sfsA-dksA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_274 160641 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_275 (cluster) 160652 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_277 (cluster) 160761 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_278 160873 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_279 160884 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_280 161071 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_281 (cluster) 161079 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_282 161142 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_283 161187 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_284 (cluster) 161195 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_285 161199 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_286 161665 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kawamukai M., Utsumi R., Takeda K., Higashi A., Matsuda H., Choi YL., Komano T., 1991, Nucleotide sequence and characterization of the sfs1 gene: sfs1 is involved in CRP*-dependent mal gene expression in Escherichia coli., J Bacteriol 173(8):2644-8

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB