RegulonDB RegulonDB 10.9: Gene Form
   

speA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speA speB yqgB PurR terminator speAp speAp TSS_3265 TSS_3265 TSS_3264 TSS_3264 TSS_3263 TSS_3263 speBp speBp

Gene      
Name: speA    Texpresso search in the literature
Synonym(s): ECK2933, EG10959, b2938
Genome position(nucleotides): 3083935 <-- 3085911 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.27
External database links:  
ASAP:
ABE-0009634
CGSC:
161
ECHOBASE:
EB0952
ECOLIHUB:
speA
OU-MICROARRAY:
b2938
STRING:
511145.b2938
COLOMBOS: speA


Product      
Name: arginine decarboxylase, biosynthetic
Synonym(s): SpeA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 73.898
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
307 -> 317 FDVGGGLGVDY
606 -> 655 VADMLQYVQLDPKTLLTQFRDQVKKTDLDAELQQQFLEEFEAGLYGYTYL
100 -> 367 LRSINAAFKRARESYGYNGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMGHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQGSGKWQSSGGEKSKFGLAATQVLQLVETLREAGRLDSLQLLHFHLGSQMANIRDIATGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITESGRAVTA
392 -> 478 EDAPRALQSMWETWQEMHEPGTRRSLREWLHDSQMDLHDIHIGYSSGIFSLQERAWAEQLYLSMCHEVQKQLDPQNRAHRPIIDELQ
226 -> 226 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016831 - carboxy-lyase activity
GO:0008792 - arginine decarboxylase activity
biological_process GO:0006596 - polyamine biosynthetic process
GO:0006527 - arginine catabolic process
GO:0008295 - spermidine biosynthetic process
GO:0009446 - putrescine biosynthetic process
GO:0033388 - putrescine biosynthetic process from arginine
External database links:  
DIP:
DIP-10905N
ECOCYC:
ARGDECARBOXBIO-MONOMER
ECOLIWIKI:
b2938
INTERPRO:
IPR029066
INTERPRO:
IPR022653
INTERPRO:
IPR022657
INTERPRO:
IPR022644
INTERPRO:
IPR041128
INTERPRO:
IPR040634
INTERPRO:
IPR000183
INTERPRO:
IPR002985
INTERPRO:
IPR009006
MODBASE:
P21170
PANTHER:
PTHR43295
PDB:
3NZQ
PFAM:
PF17810
PFAM:
PF17944
PFAM:
PF02784
PRIDE:
P21170
PRINTS:
PR01179
PRINTS:
PR01180
PRODB:
PRO_000023971
PROSITE:
PS00879
PROSITE:
PS00878
REFSEQ:
NP_417413
SMR:
P21170
UNIPROT:
P21170


Operon      
Name: speAB         
Operon arrangement:
Transcription unit        Promoter
speB
speAB


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3263 3084201 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3264 3084894 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3265 3085378 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB