RegulonDB RegulonDB 10.9: Gene Form
   

speB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speA speB loiP terminator TSS_3265 TSS_3265 TSS_3264 TSS_3264 TSS_3263 TSS_3263 speBp speBp

Gene      
Name: speB    Texpresso search in the literature
Synonym(s): ECK2932, EG10960, b2937
Genome position(nucleotides): 3082877 <-- 3083797 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.61
External database links:  
ASAP:
ABE-0009632
CGSC:
160
ECHOBASE:
EB0953
ECOLIHUB:
speB
OU-MICROARRAY:
b2937
STRING:
511145.b2937
COLOMBOS: speB


Product      
Name: agmatinase
Synonym(s): SpeB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.557
Isoelectric point: 5.016
Motif(s):
 
Type Positions Sequence
34 -> 296 DWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEM
163 -> 163 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016813 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
GO:0008783 - agmatinase activity
GO:0030145 - manganese ion binding
biological_process GO:0033389 - putrescine biosynthetic process from arginine, using agmatinase
GO:0006596 - polyamine biosynthetic process
GO:0008295 - spermidine biosynthetic process
GO:0009446 - putrescine biosynthetic process
GO:0033388 - putrescine biosynthetic process from arginine
External database links:  
DIP:
DIP-10906N
ECOCYC:
AGMATIN-MONOMER
ECOLIWIKI:
b2937
INTERPRO:
IPR006035
INTERPRO:
IPR023696
INTERPRO:
IPR023694
INTERPRO:
IPR020855
INTERPRO:
IPR005925
MODBASE:
P60651
PFAM:
PF00491
PRIDE:
P60651
PRODB:
PRO_000023972
PROSITE:
PS51409
PROSITE:
PS01053
REFSEQ:
NP_417412
SMR:
P60651
SWISSMODEL:
P60651
UNIPROT:
P60651


Operon      
Name: speAB         
Operon arrangement:
Transcription unit        Promoter
speB
speAB


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3263 3084201 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3264 3084894 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3265 3085378 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB