RegulonDB RegulonDB 10.9: Gene Form
   

gutQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: gutQ    Texpresso search in the literature
Synonym(s): ECK2703, EG10973, b2708, srlQ
Genome position(nucleotides): 2829813 --> 2830778 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.35
External database links:  
ASAP:
ABE-0008902
CGSC:
33206
ECHOBASE:
EB0966
ECOLIHUB:
gutQ
OU-MICROARRAY:
b2708
STRING:
511145.b2708
COLOMBOS: gutQ


Product      
Name: D-arabinose 5-phosphate isomerase GutQ
Synonym(s): GutQ, SrlQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.031
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
269 -> 321 MTVGGTTLQSQSRAIDAKEILMKRKITAAPVVDENGKLTGAINLQDFYQAGII
39 -> 170 LHCEGKVVVSGIGKSGHIGKKIAATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKELDLIIPRLEDKSIALLAMTGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMMGDALAMA
141 -> 143 SVE
34 -> 177 AANIILHCEGKVVVSGIGKSGHIGKKIAATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKELDLIIPRLEDKSIALLAMTGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMMGDALAMAVMQARGF
49 -> 54 GIGKSG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0019146 - arabinose-5-phosphate isomerase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0097367 - carbohydrate derivative binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0019294 - keto-3-deoxy-D-manno-octulosonic acid biosynthetic process
GO:0044010 - single-species biofilm formation
GO:0051289 - protein homotetramerization
GO:1901135 - carbohydrate derivative metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10973-MONOMER
ECOLIWIKI:
b2708
INTERPRO:
IPR035474
INTERPRO:
IPR004800
INTERPRO:
IPR001347
INTERPRO:
IPR000644
MODBASE:
P17115
PFAM:
PF01380
PFAM:
PF00571
PRIDE:
P17115
PROSITE:
PS51464
PROSITE:
PS51371
REFSEQ:
NP_417188
SMR:
P17115
UNIPROT:
P17115


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3017 (cluster) 2828961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3018 (cluster) 2829709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3019 2829746 forward nd [RS-EPT-CBR] [1]



RegulonDB