RegulonDB RegulonDB 10.9: Gene Form
   

sucA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sucA sucB sdhB b0725 TSS_853 (cluster) TSS_853 (cluster) TSS_852 TSS_852 TSS_851 TSS_851 TSS_850 TSS_850 TSS_849 TSS_849 TSS_848 (cluster) TSS_848 (cluster) TSS_847 TSS_847 sucAp sucAp TSS_846 TSS_846 TSS_845 TSS_845 TSS_844 (cluster) TSS_844 (cluster) TSS_843 (cluster) TSS_843 (cluster)

Gene      
Name: sucA    Texpresso search in the literature
Synonym(s): ECK0714, EG10979, b0726, lys+met
Genome position(nucleotides): 758706 --> 761507 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.67
External database links:  
ASAP:
ABE-0002478
CGSC:
146
ECHOBASE:
EB0972
ECOLIHUB:
sucA
OU-MICROARRAY:
b0726
STRING:
511145.b0726
COLOMBOS: sucA


Product      
Name: subunit of E1(0) component of 2-oxoglutarate dehydrogenase
Synonym(s): E1(o) subunit, Lys, SucA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 105.062
Isoelectric point: 6.465
Motif(s):
 
Type Positions Sequence
337 -> 337 R
454 -> 454 C
533 -> 533 W
404 -> 404 S
788 -> 930 VSSLEELANGTFLPAIGEIDELDPKGVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVWCQEEPLNQGAWYCSQHHFREVIPFGASLRYAGRPASASPAVGYMSVHQKQQQDLVNDAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0045252 - oxoglutarate dehydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0000166 - nucleotide binding
GO:0004591 - oxoglutarate dehydrogenase (succinyl-transferring) activity
GO:0016624 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
GO:0042802 - identical protein binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-36225N
ECOCYC:
E1O-MONOMER
ECOLIWIKI:
b0726
INTERPRO:
IPR001017
INTERPRO:
IPR032106
INTERPRO:
IPR031717
INTERPRO:
IPR042179
INTERPRO:
IPR005475
INTERPRO:
IPR011603
INTERPRO:
IPR029061
MINT:
P0AFG3
MODBASE:
P0AFG3
PANTHER:
PTHR23152
PDB:
2JGD
PFAM:
PF16870
PFAM:
PF16078
PFAM:
PF02779
PFAM:
PF00676
PRIDE:
P0AFG3
PRODB:
PRO_000024002
REFSEQ:
NP_415254
SMART:
SM00861
SMR:
P0AFG3
UNIPROT:
P0AFG3


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_843 (cluster) 758036 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_844 (cluster) 758044 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_845 758063 forward nd [RS-EPT-CBR] [1]
  promoter TSS_846 758585 forward nd [RS-EPT-CBR] [1]
  promoter TSS_847 761388 forward nd [RS-EPT-CBR] [1]
  promoter TSS_848 (cluster) 761444 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_849 761455 forward nd [RS-EPT-CBR] [1]
  promoter TSS_850 761476 forward nd [RS-EPT-CBR] [1]
  promoter TSS_851 761724 forward nd [RS-EPT-CBR] [1]
  promoter TSS_852 761850 forward nd [RS-EPT-CBR] [1]
  promoter TSS_853 (cluster) 762415 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB