RegulonDB RegulonDB 10.9: Gene Form
   

trhO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trhO lpxL yceI yceAp yceAp lpxLp lpxLp

Gene      
Name: trhO    Texpresso search in the literature
Synonym(s): ECK1040, EG11116, b1055, yceA
Genome position(nucleotides): 1116807 --> 1117859 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.76
External database links:  
ASAP:
ABE-0003581
ECHOBASE:
EB1106
ECOLIHUB:
yceA
OU-MICROARRAY:
b1055
STRING:
511145.b1055
COLOMBOS: trhO


Product      
Name: tRNA U34 hydroxylase TrhO
Synonym(s): TrhO, UPF0176 protein YceA, YceA, tRNA wobble base hydroxylase TrhO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.781
Isoelectric point: 6.44
Motif(s):
 
Type Positions Sequence
200 -> 200 C
202 -> 202 G
203 -> 203 G
82 -> 83 QL
138 -> 233 AAEVNAMLDDPDALFIDMRNHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYAR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.5 - tRNA
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0016705 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
biological_process GO:0006400 - tRNA modification
GO:0008033 - tRNA processing
GO:0055114 - oxidation-reduction process
GO:0002098 - tRNA wobble uridine modification
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Sakai Y., et al., 2019
External database links:  
DIP:
DIP-11521N
ECOCYC:
EG11116-MONOMER
ECOLIWIKI:
b1055
INTERPRO:
IPR020936
INTERPRO:
IPR040503
INTERPRO:
IPR036873
INTERPRO:
IPR022111
INTERPRO:
IPR001763
MODBASE:
P24188
PFAM:
PF00581
PFAM:
PF12368
PFAM:
PF17773
PRIDE:
P24188
PROSITE:
PS50206
REFSEQ:
NP_415573
SMART:
SM00450
SMR:
P24188
UNIPROT:
P24188


Operon      
Name: trhO         
Operon arrangement:
Transcription unit        Promoter
yceA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sakai Y., Kimura S., Suzuki T., 2019, Dual pathways of tRNA hydroxylation ensure efficient translation by expanding decoding capability., Nat Commun 10(1):2858


RegulonDB