RegulonDB RegulonDB 11.0: Gene Form

yciH gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

lapB pyrF yciH osmB pyrFp pyrFp

Name: yciH    Texpresso search in the literature
Synonym(s): ECK1277, EG11128, b1282
Genome position(nucleotides): 1342658 --> 1342984
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: putative translation factor
Synonym(s): YciH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.396
Isoelectric point: 9.94
Type Positions Sequence Comment
1 -> 31 MSDSNSRLVYSTETGRIDEPKAAPVRPKGDG UniProt: Disordered; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003729 - mRNA binding
GO:0003743 - translation initiation factor activity
GO:0043024 - ribosomal small subunit binding
biological_process GO:0006412 - translation
GO:0006413 - translational initiation
GO:0006417 - regulation of translation
GO:0001731 - formation of translation preinitiation complex
GO:0002188 - translation reinitiation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IGI] Inferred from genetic interaction
Reference(s): [1] Cort JR., et al., 1999
[2] Gagarinova A., et al., 2016
External database links:  

Name: lapAB-pyrF-yciH         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


 [1] Cort JR., Koonin EV., Bash PA., Kennedy MA., 1999, A phylogenetic approach to target selection for structural genomics: solution structure of YciH., Nucleic Acids Res 27(20):4018-27

 [2] Gagarinova A., Stewart G., Samanfar B., Phanse S., White CA., Aoki H., Deineko V., Beloglazova N., Yakunin AF., Golshani A., Brown ED., Babu M., Emili A., 2016, Systematic Genetic Screens Reveal the Dynamic Global Functional Organization of the Bacterial Translation Machinery., Cell Rep 17(3):904-916
