RegulonDB RegulonDB 10.9: Gene Form
   

mscS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fbaA mscS argO Lrp Lrp ArgP Lrp ArgP anti-anti-terminator anti-terminator terminator TSS_3221 TSS_3221 TSS_3220 TSS_3220 TSS_3219 (cluster) TSS_3219 (cluster) TSS_3218 (cluster) TSS_3218 (cluster) TSS_3217 TSS_3217 TSS_3216 TSS_3216 TSS_3215 TSS_3215 TSS_3214 TSS_3214 TSS_3213 TSS_3213 TSS_3212 TSS_3212 TSS_3211 TSS_3211 TSS_3210 TSS_3210 TSS_3209 TSS_3209 mscSp mscSp argOp argOp yggEp2 yggEp2

Gene      
Name: mscS    Texpresso search in the literature
Synonym(s): ECK2920, EG11160, b2924, yggB
Genome position(nucleotides): 3068947 <-- 3069807 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.94
External database links:  
ASAP:
ABE-0009595
ECHOBASE:
EB1149
ECOLIHUB:
mscS
OU-MICROARRAY:
b2924
STRING:
511145.b2924
COLOMBOS: mscS


Product      
Name: small conductance mechanosensitive channel MscS
Synonym(s): MscS, YggB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.896
Isoelectric point: 8.799
Motif(s):
 
Type Positions Sequence
29 -> 57 VNIVAALAIIIVGLIIARMISNAVNRLMI
31 -> 52 IVAALAIIIVGLIIARMISNAV
72 -> 268 LVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISF
91 -> 111 VQTASVIAVLGAAGLAVGLAL
267 -> 267 S

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.A - alpha-type channels
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008381 - mechanosensitive ion channel activity
GO:0042802 - identical protein binding
biological_process GO:0006811 - ion transport
GO:0009992 - cellular water homeostasis
GO:0051260 - protein homooligomerization
GO:0034220 - ion transmembrane transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Akitake B., et al., 2007
[2] Batiza AF., et al., 2002
[3] Bezanilla F., et al., 2002
[4] Biggin PC., et al., 2003
[5] Calladine CR., et al., 2003
[6] Chiang CS., et al., 2004
[7] Edwards MD., et al., 2005
[8] Grajkowski W., et al., 2005
[9] Kloda A., et al., 2002
[10] Li Y., et al., 2002
[11] Macdonald AG., et al., 2005
[12] Martinac B. 2005
[13] Miller S., et al., 2003
[14] Nomura T., et al., 2006
[15] Okada K., et al., 2002
[16] Shapovalov G., et al., 2004
[17] Sotomayor M., et al., 2004
[18] Vasquez V., et al., 2008
[19] Zhu L., et al., 2019
External database links:  
DIP:
DIP-36192N
ECOCYC:
EG11160-MONOMER
ECOLIWIKI:
b2924
INTERPRO:
IPR008910
INTERPRO:
IPR006686
INTERPRO:
IPR023408
INTERPRO:
IPR010920
INTERPRO:
IPR011014
INTERPRO:
IPR011066
INTERPRO:
IPR006685
MODBASE:
P0C0S1
PDB:
6RLD
PDB:
6PWP
PDB:
6PWO
PDB:
6PWN
PDB:
5AJI
PDB:
4HWA
PDB:
4AGF
PDB:
4AGE
PDB:
3UDC
PDB:
2VV5
PDB:
2OAU
PFAM:
PF00924
PFAM:
PF05552
PRIDE:
P0C0S1
PRODB:
PRO_000023297
PROSITE:
PS01246
REFSEQ:
NP_417399
SMR:
P0C0S1
SWISSMODEL:
P0C0S1
UNIPROT:
P0C0S1


Operon      
Name: mscS         
Operon arrangement:
Transcription unit        Promoter
mscS


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3209 3070765 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3210 3070776 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3211 3070817 forward nd [RS-EPT-CBR] [20]
  promoter TSS_3212 3070829 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3213 3070877 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3214 3070946 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3215 3070948 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3216 3070980 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3217 3071020 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3218 (cluster) 3071228 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [20]
  promoter TSS_3219 (cluster) 3071234 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [20]
  promoter TSS_3220 3071237 reverse nd [RS-EPT-CBR] [20]
  promoter TSS_3221 3071240 reverse nd [RS-EPT-CBR] [20]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Akitake B., Spelbrink RE., Anishkin A., Killian JA., de Kruijff B., Sukharev S., 2007, 2,2,2-Trifluoroethanol changes the transition kinetics and subunit interactions in the small bacterial mechanosensitive channel MscS., Biophys J 92(8):2771-84

 [2] Batiza AF., Kuo MM., Yoshimura K., Kung C., 2002, Gating the bacterial mechanosensitive channel MscL invivo., Proc Natl Acad Sci U S A 99(8):5643-8

 [3] Bezanilla F., Perozo E., 2002, Structural biology. Force and voltage sensors in one structure., Science 298(5598):1562-3

 [4] Biggin PC., Sansom MS., 2003, Mechanosensitive channels: stress relief., Curr Biol 13(5):R183-5

 [5] Calladine CR., Pratap V., Chandran V., Mizuguchi K., Luisi BF., 2003, Cylindrical channels from concave helices., Science 299(5607):661-2

 [6] Chiang CS., Anishkin A., Sukharev S., 2004, Gating of the large mechanosensitive channel in situ: estimation of the spatial scale of the transition from channel population responses., Biophys J 86(5):2846-61

 [7] Edwards MD., Li Y., Kim S., Miller S., Bartlett W., Black S., Dennison S., Iscla I., Blount P., Bowie JU., Booth IR., 2005, Pivotal role of the glycine-rich TM3 helix in gating the MscS mechanosensitive channel., Nat Struct Mol Biol 12(2):113-9

 [8] Grajkowski W., Kubalski A., Koprowski P., 2005, Surface changes of the mechanosensitive channel MscS upon its activation, inactivation, and closing., Biophys J 88(4):3050-9

 [9] Kloda A., Martinac B., 2002, Mechanosensitive channels of bacteria and archaea share a common ancestral origin., Eur Biophys J 31(1):14-25

 [10] Li Y., Moe PC., Chandrasekaran S., Booth IR., Blount P., 2002, Ionic regulation of MscK, a mechanosensitive channel from Escherichia coli., EMBO J 21(20):5323-30

 [11] Macdonald AG., Martinac B., 2005, Effect of high hydrostatic pressure on the bacterial mechanosensitive channel MscS., Eur Biophys J 34(5):434-41

 [12] Martinac B., 2005, Structural plasticity in MS channels., Nat Struct Mol Biol 12(2):104-5

 [13] Miller S., Bartlett W., Chandrasekaran S., Simpson S., Edwards M., Booth IR., 2003, Domain organization of the MscS mechanosensitive channel of Escherichia coli., EMBO J 22(1):36-46

 [14] Nomura T., Sokabe M., Yoshimura K., 2006, Lipid-protein interaction of the MscS mechanosensitive channel examined by scanning mutagenesis., Biophys J 91(8):2874-81

 [15] Okada K., Moe PC., Blount P., 2002, Functional design of bacterial mechanosensitive channels. Comparisons and contrasts illuminated by random mutagenesis., J Biol Chem 277(31):27682-8

 [16] Shapovalov G., Lester HA., 2004, Gating transitions in bacterial ion channels measured at 3 microns resolution., J Gen Physiol 124(2):151-61

 [17] Sotomayor M., Schulten K., 2004, Molecular dynamics study of gating in the mechanosensitive channel of small conductance MscS., Biophys J 87(5):3050-65

 [18] Vasquez V., Sotomayor M., Cordero-Morales J., Schulten K., Perozo E., 2008, A structural mechanism for MscS gating in lipid bilayers., Science 321(5893):1210-4

 [19] Zhu L., Zhao W., Yan Y., Liao X., Bourtsalas A., Dan Y., Xiao H., Chen X., 2019, Interaction between mechanosensitive channels embedded in lipid membrane., J Mech Behav Biomed Mater 103:103543

 [20] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB