RegulonDB RegulonDB 10.9: Gene Form
   

zupT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygiD zupT yqiD terminator TSS_3346 TSS_3346 TSS_3345 TSS_3345 ygiDp2 ygiDp2 TSS_3344 TSS_3344 TSS_3343 TSS_3343 TSS_3342 TSS_3342 zupTp zupTp ygiDp3 ygiDp3 TSS_3341 (cluster) TSS_3341 (cluster)

Gene      
Name: zupT    Texpresso search in the literature
Synonym(s): ECK3031, EG11167, b3040, ygiE
Genome position(nucleotides): 3182550 --> 3183323 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.1
Reference(s): [1] Grass G., et al., 2002
External database links:  
ASAP:
ABE-0009977
ECHOBASE:
EB1155
ECOLIHUB:
zupT
OU-MICROARRAY:
b3040
STRING:
511145.b3040
COLOMBOS: zupT


Product      
Name: heavy metal divalent cation transporter ZupT
Synonym(s): YgiE, ZupT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.485
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
33 -> 53 LAFSLGFAAGIMLLISLMEML
61 -> 81 GMSPVLGYGMFIFGLLGYFGL
98 -> 246 VQPLPKSIKRTAILLTLGISLHNFPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLAEILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCGMSVMGF
109 -> 129 AILLTLGISLHNFPEGIATFV
236 -> 256 GVLCGMSVMGFSLVLLQTAGI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005385 - zinc ion transmembrane transporter activity
GO:0005375 - copper ion transmembrane transporter activity
GO:0005384 - manganese ion transmembrane transporter activity
GO:0015086 - cadmium ion transmembrane transporter activity
GO:0015087 - cobalt ion transmembrane transporter activity
GO:0015093 - ferrous iron transmembrane transporter activity
GO:0046873 - metal ion transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0030001 - metal ion transport
GO:0006824 - cobalt ion transport
GO:0006829 - zinc ion transport
GO:0055085 - transmembrane transport
GO:0034755 - iron ion transmembrane transport
GO:0071577 - zinc ion transmembrane transport
GO:0035434 - copper ion transmembrane transport
GO:0070574 - cadmium ion transmembrane transport
GO:0071421 - manganese ion transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [2] Kashyap DR., et al., 2017
[3] Serres MH., et al., 2001
External database links:  
ECOCYC:
EG11167-MONOMER
ECOLIWIKI:
b3040
INTERPRO:
IPR023498
INTERPRO:
IPR003689
PFAM:
PF02535
PRIDE:
P0A8H3
PRODB:
PRO_000024258
REFSEQ:
NP_417512
UNIPROT:
P0A8H3


Operon      
Name: zupT         
Operon arrangement:
Transcription unit        Promoter
zupT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3341 (cluster) 3182422 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter ygiDp3 3182429 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_3342 3182440 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3343 3182450 forward nd [RS-EPT-CBR] [4]
  promoter TSS_3344 3182452 forward nd [RS-EPT-CBR] [4]
  promoter ygiDp2 3182561 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_3345 3183378 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3346 3183398 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Grass G., Wong MD., Rosen BP., Smith RL., Rensing C., 2002, ZupT is a Zn(II) uptake system in Escherichia coli., J Bacteriol 184(3):864-6

 [2] Kashyap DR., Kuzma M., Kowalczyk DA., Gupta D., Dziarski R., 2017, Bactericidal peptidoglycan recognition protein induces oxidative stress in Escherichia coli through a block in respiratory chain and increase in central carbon catabolism., Mol Microbiol 105(5):755-776

 [3] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB