RegulonDB RegulonDB 10.9: Gene Form
   

yidB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yidB    Texpresso search in the literature
Synonym(s): ECK3690, EG11196, b3698
Genome position(nucleotides): 3877067 <-- 3877465 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.13
External database links:  
ASAP:
ABE-0012089
ECHOBASE:
EB1182
ECOLIHUB:
yidB
OU-MICROARRAY:
b3698
STRING:
511145.b3698
COLOMBOS: yidB


Product      
Name: DUF937 domain-containing protein YidB
Synonym(s): YidB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.787
Isoelectric point: 4.113
Motif(s):
 
Type Positions Sequence
21 -> 107 AILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQQGNQSVSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKIIDALSPQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG11196-MONOMER
ECOLIWIKI:
b3698
INTERPRO:
IPR009282
INTERPRO:
IPR027405
PFAM:
PF06078
PRIDE:
P09996
REFSEQ:
NP_418153
SMR:
P09996
SWISSMODEL:
P09996
UNIPROT:
P09996


Operon      
Name: yidB         
Operon arrangement:
Transcription unit        Promoter
yidB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4258 (cluster) 3876977 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter yidBp3 3877615 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_4259 3878251 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4260 (cluster) 3878769 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4261 3878772 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4262 3879127 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4263 3879564 reverse nd [RS-EPT-CBR] [2]



RegulonDB