RegulonDB RegulonDB 10.10: Gene Form
   

yjaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metA yjaB yjaA MetJ MetJ metAp1 metAp1 metAp2 metAp2 yjaBp yjaBp

Gene      
Name: yjaB    Texpresso search in the literature
Synonym(s): ECK4004, EG11207, b4012
Genome position(nucleotides): 4213680 <-- 4214123 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.5
Reference(s): [1] Gery S., et al., 1997
External database links:  
ASAP:
ABE-0013114
ECHOBASE:
EB1192
ECOLIHUB:
yjaB
OU-MICROARRAY:
b4012
STRING:
511145.b4012
COLOMBOS: yjaB


Shine dalgarno      
Sequence: gaatgactaaAAGGAGagaaAAT


Product      
Name: peptidyl-lysine N-acetyltransferase YjaB
Synonym(s): YjaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.447
Isoelectric point: 4.584
Motif(s):
 
Type Positions Sequence
46 -> 131 FLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDPDVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVD
3 -> 144 ISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDPDVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLAY
117 -> 117 Y
128 -> 128 S
147 -> 147 A

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - acyltransferase activity
GO:0061733 - peptide-lysine-N-acetyltransferase activity
biological_process GO:0018393 - internal peptidyl-lysine acetylation
GO:0018215 - protein phosphopantetheinylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11207-MONOMER
ECOLIWIKI:
b4012
INTERPRO:
IPR016181
INTERPRO:
IPR000182
MODBASE:
P09163
PDB:
2KCW
PFAM:
PF13673
PRIDE:
P09163
PROSITE:
PS51186
REFSEQ:
NP_418436
SMR:
P09163
UNIPROT:
P09163


Operon      
Name: yjaB         
Operon arrangement:
Transcription unit        Promoter
yjaB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjaBp 4214156 reverse nd [AIPP], [ICWHO] [1], [2]


Evidence    

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gery S., Ron EZ., 1997, An Escherichia coli gene divergently transcribed from a promoter overlapping the metA promoter., FEMS Microbiol Lett 154(2):219-22

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB