RegulonDB RegulonDB 10.9: Gene Form
   

yjjA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgB dnaC yjjA terminator yjjAp1 yjjAp1 yjjAp8 yjjAp8 opgBp7 opgBp7 TSS_5156 TSS_5156 TSS_5155 TSS_5155

Gene      
Name: yjjA    Texpresso search in the literature
Synonym(s): ECK4350, EG11214, b4360
Genome position(nucleotides): 4599695 <-- 4600189 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.51
External database links:  
ASAP:
ABE-0014301
ECHOBASE:
EB1198
ECOLIHUB:
yjjA
OU-MICROARRAY:
b4360
STRING:
511145.b4360
COLOMBOS: yjjA


Product      
Name: DUF2501 domain-containing protein YjjA
Synonym(s): YjjA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.353
Isoelectric point: 5.741
Motif(s):
 
Type Positions Sequence
26 -> 164 ASWKDALSSAASELGNQNSTTQEGGWSLASLTNLLSSGNQALSADNMNNAAGILQYCAKQKLASVTDAENIKNQVLEKLGLNSEEQKEDTNYLDGIQGLLKTKDGQQLNLDNIGTTPLAEKVKTKACDLVLKQGLNFIS
74 -> 75 NA
84 -> 162 KQKLASVTDAENIKNQVLEKLGLNSEEQKEDTNYLDGIQGLLKTKDGQQLNLDNIGTTPLAEKVKTKACDLVLKQGLNF
1 -> 25 MMKTVKHLLCCAIAASALISTGVHA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11214-MONOMER
ECOLIWIKI:
b4360
INTERPRO:
IPR019637
PFAM:
PF10696
PRIDE:
P18390
REFSEQ:
NP_418780
UNIPROT:
P18390


Operon      
Name: yjjB-dnaTC-yjjA         
Operon arrangement:
Transcription unit        Promoter
dnaTC
dnaTC-yjjA
yjjB-dnaTC
yjjB-dnaTC-yjjA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5155 4597417 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5156 4599493 reverse nd [RS-EPT-CBR] [1]
  promoter opgBp7 4599494 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yjjAp8 4600210 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yjjAp1 4600337 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB