RegulonDB RegulonDB 10.9: Gene Form
   

rsfS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cobC rlmH rsfS rsfSp rsfSp TSS_760 TSS_760

Gene      
Name: rsfS    Texpresso search in the literature
Synonym(s): ECK0630, EG11255, b0637, rsfA, ybeB
Genome position(nucleotides): 668719 <-- 669036 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.26
External database links:  
ASAP:
ABE-0002183
ECHOBASE:
EB1235
ECOLIHUB:
ybeB
OU-MICROARRAY:
b0637
STRING:
511145.b0637
COLOMBOS: rsfS


Product      
Name: ribosomal silencing factor RsfS
Synonym(s): RsfA, RsfS, YbeB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.582
Isoelectric point: 4.304
Motif(s):
 
Type Positions Sequence
10 -> 104 VIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0043023 - ribosomal large subunit binding
biological_process GO:0006417 - regulation of translation
GO:0017148 - negative regulation of translation
GO:0042256 - mature ribosome assembly
GO:0090071 - negative regulation of ribosome biogenesis
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IDA] Inferred from direct assay
Reference(s): [1] Chen SS., et al., 2013
[2] Hauser R., et al., 2012
[3] Walbot V., et al., 1979
External database links:  
DIP:
DIP-48141N
ECOCYC:
EG11255-MONOMER
ECOLIWIKI:
b0637
INTERPRO:
IPR004394
INTERPRO:
IPR043519
PANTHER:
PTHR21043
PFAM:
PF02410
PRIDE:
P0AAT6
REFSEQ:
NP_415170
SMR:
P0AAT6
UNIPROT:
P0AAT6


Operon      
Name: rsfS-rlmH-mrdAB-rlpA         
Operon arrangement:
Transcription unit        Promoter
rsfS-rlmH-mrdAB-rlpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_760 668468 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chen SS., Williamson JR., 2013, Characterization of the ribosome biogenesis landscape in E. coli using quantitative mass spectrometry., J Mol Biol 425(4):767-79

 [2] Hauser R., Pech M., Kijek J., Yamamoto H., Titz B., Naeve F., Tovchigrechko A., Yamamoto K., Szaflarski W., Takeuchi N., Stellberger T., Diefenbacher ME., Nierhaus KH., Uetz P., 2012, RsfA (YbeB) proteins are conserved ribosomal silencing factors., PLoS Genet 8(7):e1002815

 [3] Walbot V., Coe EH., 1979, Nuclear gene iojap conditions a programmed change to ribosome-less plastids in Zea mays., Proc Natl Acad Sci U S A 76(6):2760-2764

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB