RegulonDB RegulonDB 10.9: Gene Form
   

waaH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

envC waaH tdh yibQ NsrR PhoB PhoB anti-anti-terminator anti-terminator terminator yibDp1 yibDp1 TSS_4202 TSS_4202

Gene      
Name: waaH    Texpresso search in the literature
Synonym(s): ECK3605, EG11266, b3615, yibD
Genome position(nucleotides): 3789047 <-- 3790081 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.99
External database links:  
ASAP:
ABE-0011826
ECHOBASE:
EB1245
ECOLIHUB:
yibD
OU-MICROARRAY:
b3615
STRING:
511145.b3615
COLOMBOS: waaH


Product      
Name: UDP-glucuronate:LPS(HepIII) glycosyltransferase
Synonym(s): WaaH, YibD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 40.524
Isoelectric point: 9.589
Motif(s):
 
Type Positions Sequence
77 -> 77 R
9 -> 138 SVIIPLYNAGDDFRTCMESLITQTWTALEIIIINDGSTDNSVEIAKYYAENYPHVRLLHQANAGASVARNRGIEVATGKYVAFVDADDEVYPTMYETLMTMALEDDLDVAQCNADWCFRETGETWQSIPT
1 -> 26 MMNSTNKLSVIIPLYNAGDDFRTCME

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0015020 - glucuronosyltransferase activity
biological_process GO:0016036 - cellular response to phosphate starvation
Note(s): Note(s): ...[more].
Reference(s): [1] Lee LJ., et al., 2005
External database links:  
CAZY:
GT2
ECOCYC:
EG11266-MONOMER
ECOLIWIKI:
b3615
INTERPRO:
IPR001173
INTERPRO:
IPR029044
MODBASE:
P11290
PFAM:
PF00535
PRIDE:
P11290
REFSEQ:
NP_418072
SMR:
P11290
UNIPROT:
P11290


Operon      
Name: waaH         
Operon arrangement:
Transcription unit        Promoter
yibD
yibD


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB
Repressed by: NsrR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4202 3786964 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lee LJ., Barrett JA., Poole RK., 2005, Genome-wide transcriptional response of chemostat-cultured Escherichia coli to zinc., J Bacteriol 187(3):1124-34

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB