RegulonDB RegulonDB 11.1: Gene Form
   

yiaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xylB yiaA yiaB yiaBp6 yiaBp6 yiaBp1 yiaBp1 yiaBp5 yiaBp5 TSS_4170 TSS_4170

Gene      
Name: yiaB    Texpresso search in the literature
Synonym(s): ECK3552, EG11267, b3563
Genome position(nucleotides): 3727407 <-- 3727748
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.52
External database links:  
ASAP:
ABE-0011634
ECHOBASE:
EB1246
ECOLIHUB:
yiaB
OU-MICROARRAY:
b3563
STRING:
511145.b3563
COLOMBOS: yiaB


Product      
Name: PF05360 family inner membrane protein YiaB
Synonym(s): YiaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.555
Isoelectric point: 9.165
Motif(s):
 
Type Positions Sequence Comment
6 -> 50 TVAKLLFVVGALVYLVGLWISCPLLSGKGYFLGVLMTATFGNYAY
10 -> 20 LLFVVGALVYL UniProt: Helical.
34 -> 51 GYFLGVLMTATFGNYAYL UniProt: Helical.
62 -> 82 FFTHICQLVALITIGLLFIGV UniProt: Helical.
77 -> 77 L UniProt: In Ref. 1; CAA28396..

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P11286
ECOCYC:
EG11267-MONOMER
ECOLIWIKI:
b3563
INTERPRO:
IPR008024
INTERPRO:
IPR038972
PANTHER:
PTHR37290
PFAM:
PF05360
PRIDE:
P11286
REFSEQ:
NP_418020
UNIPROT:
P11286


Operon      
Name: yiaB         
Operon arrangement:
Transcription unit        Promoter
yiaB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4170 3727282 reverse nd [RS-EPT-CBR] [1]
  promoter yiaBp5 3727767 reverse nd [COMP-AINF] [2]
  promoter yiaBp1 3727797 reverse nd [COMP-AINF] [2]
  promoter yiaBp6 3727827 reverse nd [COMP-AINF] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [COMP-AINF] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB