RegulonDB RegulonDB 10.9: Gene Form
   

mutL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mutL amiB miaA hfq CRP TSS_5016 TSS_5016 hfqp3 hfqp3 hfqp2 hfqp2 miaAp1 miaAp1 miaAp2 miaAp2 TSS_5013 TSS_5013 mutLp1 mutLp1 mutLp2 mutLp2

Gene      
Name: mutL    Texpresso search in the literature
Synonym(s): ECK4166, EG11281, b4170
Genome position(nucleotides): 4397412 --> 4399259 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.28
External database links:  
ASAP:
ABE-0013655
CGSC:
470
ECHOBASE:
EB1258
ECOLIHUB:
mutL
MIM:
608089
MIM:
276300
MIM:
158320
MIM:
114500
MIM:
609310
OU-MICROARRAY:
b4170
STRING:
511145.b4170
COLOMBOS: mutL


Product      
Name: DNA mismatch repair protein MutL
Synonym(s): MutL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 67.924
Isoelectric point: 6.766
Motif(s):
 
Type Positions Sequence
214 -> 330 AICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVL
24 -> 121 ASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAW
435 -> 563 FGRVLTIVHSDCALLERDGNISLLSLPVAERWLRQAQLTPGEAPVCAQPLLIPLRLKVSAEEKSALEKAQSALAELGIDFQSDAQHVTIRAVPLPLRQQNLQILIPELIGYLAKQSVFEPGNIAQWIAR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032300 - mismatch repair complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0030983 - mismatched DNA binding
GO:0042802 - identical protein binding
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0006298 - mismatch repair
GO:0000018 - regulation of DNA recombination
Note(s): Note(s): ...[more].
Reference(s): [1] Guarne A., et al., 2015
[2] Liu J., et al., 2019
External database links:  
DIP:
DIP-10285N
ECOCYC:
EG11281-MONOMER
ECOLIWIKI:
b4170
INTERPRO:
IPR037198
INTERPRO:
IPR036890
INTERPRO:
IPR020667
INTERPRO:
IPR020568
INTERPRO:
IPR014790
INTERPRO:
IPR014762
INTERPRO:
IPR014721
INTERPRO:
IPR038973
INTERPRO:
IPR013507
INTERPRO:
IPR042121
INTERPRO:
IPR042120
INTERPRO:
IPR002099
MODBASE:
P23367
PANTHER:
PTHR10073
PDB:
6E8E
PDB:
5AKD
PDB:
5AKC
PDB:
5AKB
PDB:
1X9Z
PDB:
1NHJ
PDB:
1NHI
PDB:
1NHH
PDB:
1BKN
PDB:
1B63
PDB:
1B62
PFAM:
PF13589
PFAM:
PF08676
PFAM:
PF01119
PRIDE:
P23367
PRODB:
PRO_000023324
PROSITE:
PS00058
REFSEQ:
NP_418591
SMART:
SM00853
SMART:
SM01340
SMR:
P23367
UNIPROT:
P23367


Operon      
Name: nnr-tsaE-amiB-mutL-miaA-hfq-hflXKC         
Operon arrangement:
Transcription unit        Promoter
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
miaA-hfq-hflXKC
miaA-hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
tsaE-amiB-mutL-miaA-hfq-hflXKC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5013 4398332 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5016 4400234 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Guarne A., Charbonnier JB., 2015, Insights from a decade of biophysical studies on MutL: Roles in strand discrimination and mismatch removal., Prog Biophys Mol Biol 117(2-3):149-56

 [2] Liu J., Lee R., Britton BM., London JA., Yang K., Hanne J., Lee JB., Fishel R., 2019, MutL sliding clamps coordinate exonuclease-independent Escherichia coli mismatch repair., Nat Commun 10(1):5294

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB