RegulonDB RegulonDB 10.9: Gene Form
   

dusB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dusB prmA fis Fis Fis CRP Fis Fis IHF Fis CRP Fis CRP DksA-ppGpp DksA-ppGpp ppGpp anti-anti-terminator TSS_3598 TSS_3598 TSS_3597 TSS_3597 dusBp dusBp TSS_3596 TSS_3596 TSS_3595 TSS_3595

Gene      
Name: dusB    Texpresso search in the literature
Synonym(s): ECK3247, EG11311, b3260, yhdG
Genome position(nucleotides): 3410280 --> 3411245 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.28
External database links:  
ASAP:
ABE-0010700
ECHOBASE:
EB1287
ECOLIHUB:
dusB
OU-MICROARRAY:
b3260
STRING:
511145.b3260
COLOMBOS: dusB


Product      
Name: tRNA-dihydrouridine synthase B
Synonym(s): DusB, YhdG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.866
Isoelectric point: 6.707
Motif(s):
 
Type Positions Sequence
14 -> 318 AAPMAGITDRPFRTLCYEMGAGLTVSEMMSSNPQVWESDKSRLRMVHIDEPGIRTVQIAGSDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDITDPLKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYGPAKGYRIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFE
16 -> 18 PMA
200 -> 202 NGD
224 -> 225 GR
267 -> 267 H

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0003723 - RNA binding
GO:0000049 - tRNA binding
GO:0050660 - flavin adenine dinucleotide binding
GO:0010181 - FMN binding
GO:0017150 - tRNA dihydrouridine synthase activity
biological_process GO:0008033 - tRNA processing
GO:0009314 - response to radiation
GO:0055114 - oxidation-reduction process
GO:0002943 - tRNA dihydrouridine synthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Sargentini NJ., et al., 2016
External database links:  
DIP:
DIP-48240N
ECOCYC:
EG11311-MONOMER
ECOLIWIKI:
b3260
INTERPRO:
IPR001269
INTERPRO:
IPR032887
INTERPRO:
IPR035587
INTERPRO:
IPR004652
INTERPRO:
IPR013785
INTERPRO:
IPR018517
INTERPRO:
IPR024036
MODBASE:
P0ABT5
PANTHER:
PTHR11082
PDB:
6EI9
PFAM:
PF01207
PRIDE:
P0ABT5
PRODB:
PRO_000022491
PROSITE:
PS01136
REFSEQ:
NP_417726
SMR:
P0ABT5
UNIPROT:
P0ABT5


Operon      
Name: dusB-fis         
Operon arrangement:
Transcription unit        Promoter
dusB-fis


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: CRP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3595 3409159 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3596 3409381 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3597 3410248 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3598 3410739 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB