RegulonDB RegulonDB 10.10: Gene Form
   

upp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uraA purM upp PurR FNR FNR purMp purMp TSS_2780 TSS_2780 uppp uppp

Gene      
Name: upp    Texpresso search in the literature
Synonym(s): ECK2494, EG11332, b2498, uraP
Genome position(nucleotides): 2620246 <-- 2620872 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.95
Reference(s): [1] Andersen PS., et al., 1992
[2] Cheng Y., et al., 2001
[3] Turnbough CL., et al., 2008
External database links:  
ASAP:
ABE-0008224
CGSC:
24
ECHOBASE:
EB1308
ECOLIHUB:
upp
OU-MICROARRAY:
b2498
STRING:
511145.b2498
COLOMBOS: upp


Shine dalgarno      
Sequence: ctgcccctcaAAGGAGaaagagTAT


Product      
Name: uracil phosphoribosyltransferase
Synonym(s): Upp, UraP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 22.533
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
130 -> 138 DPMLATGGS
7 -> 207 KHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWNGPVEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNEETLEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAPEGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGT
131 -> 131 P
198 -> 200 GDA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0003824 - catalytic activity
GO:0016757 - glycosyltransferase activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0004845 - uracil phosphoribosyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0097216 - guanosine tetraphosphate binding
biological_process GO:0008152 - metabolic process
GO:0006206 - pyrimidine nucleobase metabolic process
GO:0009116 - nucleoside metabolic process
GO:0016310 - phosphorylation
GO:0008655 - pyrimidine-containing compound salvage
GO:0006223 - uracil salvage
GO:0044206 - UMP salvage
External database links:  
DIP:
DIP-36228N
ECOCYC:
URACIL-PRIBOSYLTRANS-MONOMER
ECOLIWIKI:
b2498
INTERPRO:
IPR034332
INTERPRO:
IPR029057
INTERPRO:
IPR000836
INTERPRO:
IPR005765
MODBASE:
P0A8F0
PDB:
2EHJ
PFAM:
PF14681
PRIDE:
P0A8F0
REFSEQ:
NP_416993
SMR:
P0A8F0
SWISSMODEL:
P0A8F0
UNIPROT:
P0A8F0


Operon      
Name: upp-uraA         
Operon arrangement:
Transcription unit        Promoter
upp-uraA


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2780 2620986 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Andersen PS., Smith JM., Mygind B., 1992, Characterization of the upp gene encoding uracil phosphoribosyltransferase of Escherichia coli K12., Eur J Biochem 204(1):51-6

 [2] Cheng Y., Dylla SM., Turnbough CL., 2001, A long T. A tract in the upp initially transcribed region is required for regulation of upp expression by UTP-dependent reiterative transcription in Escherichia coli., J Bacteriol 183(1):221-8

 [3] Turnbough CL., Switzer RL., 2008, Regulation of pyrimidine biosynthetic gene expression in bacteria: repression without repressors., Microbiol Mol Biol Rev 72(2):266-300, table of contents

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB