RegulonDB RegulonDB 10.9: Gene Form
   

upp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uraA purM upp PurR FNR FNR purMp purMp TSS_2780 TSS_2780 uppp uppp

Gene      
Name: upp    Texpresso search in the literature
Synonym(s): ECK2494, EG11332, b2498, uraP
Genome position(nucleotides): 2620246 <-- 2620872 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.95
Reference(s): [1] Andersen PS., et al., 1992
[2] Cheng Y., et al., 2001
[3] Turnbough CL., et al., 2008
External database links:  
ASAP:
ABE-0008224
CGSC:
24
ECHOBASE:
EB1308
ECOLIHUB:
upp
OU-MICROARRAY:
b2498
STRING:
511145.b2498
COLOMBOS: upp


Shine dalgarno      
Sequence: ctgcccctcaAAGGAGaaagagTAT


Product      
Name: uracil phosphoribosyltransferase
Synonym(s): Upp, UraP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.533
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
130 -> 138 DPMLATGGS
7 -> 207 KHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWNGPVEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNEETLEPVPYFQKLVSNIDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAPEGIAALEKAHPDVELYTASIDQGLNEHGYIIPGLGDAGDKIFGT
131 -> 131 P
198 -> 200 GDA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0004845 - uracil phosphoribosyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0006206 - pyrimidine nucleobase metabolic process
GO:0009116 - nucleoside metabolic process
GO:0016310 - phosphorylation
GO:0008655 - pyrimidine-containing compound salvage
GO:0006223 - uracil salvage
GO:0044206 - UMP salvage
External database links:  
DIP:
DIP-36228N
ECOCYC:
URACIL-PRIBOSYLTRANS-MONOMER
ECOLIWIKI:
b2498
INTERPRO:
IPR029057
INTERPRO:
IPR034332
INTERPRO:
IPR000836
INTERPRO:
IPR005765
MODBASE:
P0A8F0
PDB:
2EHJ
PFAM:
PF14681
PRIDE:
P0A8F0
REFSEQ:
NP_416993
SMR:
P0A8F0
SWISSMODEL:
P0A8F0
UNIPROT:
P0A8F0


Operon      
Name: upp-uraA         
Operon arrangement:
Transcription unit        Promoter
upp-uraA


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Growth Conditions:

[1] 

C: Escherichia coli| ATP; CTP 800 µM; GTP 800 µM; UTP 800 µM| 37.0 C
E: Escherichia coli| ATP; CTP 800 µM; GTP 800 µM; UTP 50 µM| 37.0 C

[2] 

C: Escherichia coli| N-C- medium| ammonium chloride 10 mM; arginine 1 mM; glucose 0.4%; thiamine hydrochloride 0.015 mM; uracil 1 mM| 37.0 C| OD650 of 0.5
E: Escherichia coli| N-C- medium| ammonium chloride 10 mM; UMP 0.25 mM; arginine 1 mM; glucose 0.4%; thiamine hydrochloride 0.015 mM| 37.0 C| OD650 of 0.5



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2780 2620986 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Andersen PS., Smith JM., Mygind B., 1992, Characterization of the upp gene encoding uracil phosphoribosyltransferase of Escherichia coli K12., Eur J Biochem 204(1):51-6

 [2] Cheng Y., Dylla SM., Turnbough CL., 2001, A long T. A tract in the upp initially transcribed region is required for regulation of upp expression by UTP-dependent reiterative transcription in Escherichia coli., J Bacteriol 183(1):221-8

 [3] Turnbough CL., Switzer RL., 2008, Regulation of pyrimidine biosynthetic gene expression in bacteria: repression without repressors., Microbiol Mol Biol Rev 72(2):266-300, table of contents

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muńiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB