RegulonDB RegulonDB 10.9: Gene Form
   

fliF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliF fliG fliH fliE intG FlhDC CsgD FlhDC CsgD fliFp fliFp fliFp1 fliFp1 fliEp fliEp fliEp1 fliEp1

Gene      
Name: fliF    Texpresso search in the literature
Synonym(s): ECK1936, EG11347, b1938, flaAII.1, flaBI
Genome position(nucleotides): 2013229 --> 2014887 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.61
External database links:  
ASAP:
ABE-0006454
CGSC:
17707
ECHOBASE:
EB1323
ECOLIHUB:
fliF
OU-MICROARRAY:
b1938
STRING:
511145.b1938
COLOMBOS: fliF


Product      
Name: flagellar basal-body MS-ring and collar protein
Synonym(s): FliF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space,cytosol,cell projection
Molecular weight: 60.589
Isoelectric point: 6.985
Motif(s):
 
Type Positions Sequence
447 -> 467 FIDQLLAAGRWLLVLLVAWLL
44 -> 218 KAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLT
250 -> 429 LSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF
541 -> 541 L
23 -> 43 IPLIVAGSAAVAVMVALILWA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009288 - bacterial-type flagellum
GO:0009425 - bacterial-type flagellum basal body
GO:0009431 - bacterial-type flagellum basal body, MS ring
molecular_function GO:0005515 - protein binding
GO:0003774 - motor activity
GO:0042802 - identical protein binding
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [TAS] Traceable author statement
Reference(s): [1] Berg HC. 2003
[2] Komeda Y., et al., 1980
[3] Suzuki T., et al., 1981
External database links:  
DIP:
DIP-401N
ECOCYC:
FLIF-FLAGELLAR-MS-RING
ECOLIWIKI:
b1938
INTERPRO:
IPR006182
INTERPRO:
IPR043427
INTERPRO:
IPR013556
INTERPRO:
IPR000067
PANTHER:
PTHR30046:SF0
PANTHER:
PTHR30046
PFAM:
PF08345
PFAM:
PF01514
PRIDE:
P25798
PRINTS:
PR01009
PRODB:
PRO_000022657
REFSEQ:
NP_416448
SMR:
P25798
UNIPROT:
P25798


Operon      
Name: fliFGHIJK         
Operon arrangement:
Transcription unit        Promoter
fliFGHIJK
fliFGHIJK


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Berg HC., 2003, The rotary motor of bacterial flagella., Annu Rev Biochem 72:19-54

 [2] Komeda Y., Kutsukake K., Iino T., 1980, Definition of additional flagellar genes in Escherichia coli K12., Genetics 94(2):277-90

 [3] Suzuki T., Komeda Y., 1981, Incomplete flagellar structures in Escherichia coli mutants., J Bacteriol 145(2):1036-41


RegulonDB