RegulonDB RegulonDB 10.9: Gene Form
   

dinG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dinG ybiB ybiA LexA TSS_961 TSS_961 TSS_960 TSS_960 dinGp dinGp ybiAp6 ybiAp6

Gene      
Name: dinG    Texpresso search in the literature
Synonym(s): ECK0788, EG11357, b0799, rarB
Genome position(nucleotides): 833070 --> 835220 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.07
External database links:  
ASAP:
ABE-0002732
CGSC:
31247
ECHOBASE:
EB1332
ECOLIHUB:
dinG
MIM:
609054
MIM:
114480
MIM:
605882
OU-MICROARRAY:
b0799
STRING:
511145.b0799
COLOMBOS: dinG


Product      
Name: ATP-dependent DNA helicase DinG
Synonym(s): DinG, RarB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 81.44
Isoelectric point: 7.775
Motif(s):
 
Type Positions Sequence
120 -> 120 C
200 -> 264 YYYRECPFFVARREIQEAEVVVANHALVMAAMESEAVLPDPKNLLLVLDEGHHLPDVARDALEMS
211 -> 211 R
532 -> 687 KKHLGMLVLFASGRAMQRFLDYVTDLRLMLLVQGDQPRYRLVELHRKRVANGERSVLVGLQSFAEGLDLKGDLLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHGCWGEVVIYDKRLLTKNYGKRLLDAL
618 -> 618 I

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  3 - regulation --> 3.1 - type of regulation --> 3.1.1 - DNA structure level --> 3.1.1.1 - bent DNA or supercoiling, inversion
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016818 - hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0016887 - ATPase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0033677 - DNA/RNA helicase activity
biological_process GO:0006139 - nucleobase-containing compound metabolic process
GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0032508 - DNA duplex unwinding
Note(s): Note(s): ...[more].
Reference(s): [1] Courcelle J., et al., 2001
[2] Lewis LK., et al., 1992
External database links:  
ECOCYC:
EG11357-MONOMER
ECOLIWIKI:
b0799
INTERPRO:
IPR014013
INTERPRO:
IPR039000
INTERPRO:
IPR027417
INTERPRO:
IPR014001
INTERPRO:
IPR011545
INTERPRO:
IPR010614
INTERPRO:
IPR006555
INTERPRO:
IPR006554
MINT:
P27296
PDB:
6FWS
PDB:
6FWR
PFAM:
PF13307
PFAM:
PF06733
PFAM:
PF00270
PRIDE:
P27296
PROSITE:
PS51193
REFSEQ:
NP_415320
SMART:
SM00488
SMART:
SM00491
SMART:
SM00487
SMR:
P27296
UNIPROT:
P27296


Operon      
Name: dinG-ybiB         
Operon arrangement:
Transcription unit        Promoter
dinG-ybiB
ybiB


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiAp6 832960 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_960 833795 forward nd [RS-EPT-CBR] [4]
  promoter TSS_961 835181 forward nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Courcelle J., Khodursky A., Peter B., Brown PO., Hanawalt PC., 2001, Comparative gene expression profiles following UV exposure in wild-type and SOS-deficient Escherichia coli., Genetics 158(1):41-64

 [2] Lewis LK., Mount DW., 1992, Interaction of LexA repressor with the asymmetric dinG operator and complete nucleotide sequence of the gene., J Bacteriol 174(15):5110-6

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB