RegulonDB RegulonDB 10.8: Gene Form
   

bglH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bglH bglB yieL yieKp2 yieKp2

Gene      
Name: bglH    Texpresso search in the literature
Synonym(s): ECK3713, EG11364, b3720, yieC
Genome position(nucleotides): 3900604 <-- 3902220 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.15
External database links:  
ASAP:
ABE-0012165
ECHOBASE:
EB1339
OU-MICROARRAY:
b3720
PortEco:
bglH
STRING:
511145.b3720
COLOMBOS: bglH


Product      
Name: carbohydrate-specific outer membrane porin, cryptic
Synonym(s): BglH, YieC
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 60.657
Isoelectric point: 5.003
Motif(s):
 
Type Positions Sequence
26 -> 538 ESLTVEQRLELLEKALRETQSELKKYKDEEKKKYTPATVNRSVSTNDQGYAANPFPTSSAAKPDAVLVKNEEKNASETGSIYSSMTLKDFSKFVKDEIGFSYNGYYRSGWGTASHGSPKSWAIGSLGRFGNEYSGWFDLQLKQRVYNENGKRVDAVVMMDGNVGQQYSTGWFGDNAGGENYMQFSDMYVTTKGFLPFAPEADFWVGKHGAPKIEIQMLDWKTQRTDAAAGVGLENWKVGPGKIDIALVREDVDDYDRSLQNKQQINTNTIDLRYKDIPLWDKATLMVSGRYVTANESASEKDNQDNNGYYDWKDTWMFGTSLTQKFDKGGFNEFSFLVANNSIASNFGRYAGASPFTTFNGRYYGDHTGGTAVRLTSQGEAYIGDHFIVANAIVYSFGNDIYSYETGAHSDFESIRAVVRPAYIWDQYNQTGVELGYFTQQNKDANSNKFNESGYKTTLFHTFKVNTSMLTSRPEIRFYATYIKALENELDGFTFEDNKDDQFAVGAQAEIWW
127 -> 538 YNGYYRSGWGTASHGSPKSWAIGSLGRFGNEYSGWFDLQLKQRVYNENGKRVDAVVMMDGNVGQQYSTGWFGDNAGGENYMQFSDMYVTTKGFLPFAPEADFWVGKHGAPKIEIQMLDWKTQRTDAAAGVGLENWKVGPGKIDIALVREDVDDYDRSLQNKQQINTNTIDLRYKDIPLWDKATLMVSGRYVTANESASEKDNQDNNGYYDWKDTWMFGTSLTQKFDKGGFNEFSFLVANNSIASNFGRYAGASPFTTFNGRYYGDHTGGTAVRLTSQGEAYIGDHFIVANAIVYSFGNDIYSYETGAHSDFESIRAVVRPAYIWDQYNQTGVELGYFTQQNKDANSNKFNESGYKTTLFHTFKVNTSMLTSRPEIRFYATYIKALENELDGFTFEDNKDDQFAVGAQAEIWW
202 -> 251 GGENYMQFSDMYVTTKGFLPFAPEADFWVGKHGAPKIEIQMLDWKTQRTD
1 -> 25 MFRRNLITSAILLMAPLAFSAQSLA
3 -> 57 RRNLITSAILLMAPLAFSAQSLAESLTVEQRLELLEKALRETQSELKKYKDEEKK

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0031230 - intrinsic component of cell outer membrane
GO:0045203 - integral component of cell outer membrane
GO:0046930 - pore complex
molecular_function GO:0015288 - porin activity
GO:0015144 - carbohydrate transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0015774 - polysaccharide transport
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11364-MONOMER
ECOLIWIKI:
b3720
INTERPRO:
IPR003192
INTERPRO:
IPR036998
INTERPRO:
IPR021570
MODBASE:
P26218
PFAM:
PF11471
PFAM:
PF02264
PRIDE:
P26218
PRODB:
PRO_000022217
PRODOM:
PD008788
REFSEQ:
NP_418176
SMR:
P26218
UNIPROT:
P26218


Operon      
Name: bglH-yieLK         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yieKp2 3899464 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB