RegulonDB RegulonDB 10.9: Gene Form
   

menB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menE menC menB menH menD TSS_2519 (cluster) TSS_2519 (cluster) menBp menBp

Gene      
Name: menB    Texpresso search in the literature
Synonym(s): ECK2256, EG11368, b2262
Genome position(nucleotides): 2375962 <-- 2376819 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.59
External database links:  
ASAP:
ABE-0007476
CGSC:
519
ECHOBASE:
EB1342
ECOLIHUB:
menB
OU-MICROARRAY:
b2262
STRING:
511145.b2262
COLOMBOS: menB


Product      
Name: 1,4-dihydroxy-2-naphthoyl-CoA synthase
Synonym(s): MenB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.633
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
89 -> 89 K
84 -> 89 SGGDQK
129 -> 133 YSIGG
270 -> 270 F
31 -> 279 TDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIILTGAGDKAFCSGGDQKVRGDYGGYKDDSGVHHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0008935 - 1,4-dihydroxy-2-naphthoyl-CoA synthase activity
GO:0071890 - bicarbonate binding
biological_process GO:0009234 - menaquinone biosynthetic process
External database links:  
DIP:
DIP-47854N
ECOCYC:
NAPHTHOATE-SYN-MONOMER
ECOLIWIKI:
b2262
INTERPRO:
IPR029045
INTERPRO:
IPR018376
INTERPRO:
IPR014748
INTERPRO:
IPR010198
INTERPRO:
IPR001753
MODBASE:
P0ABU0
PANTHER:
PTHR43113
PDB:
3T89
PDB:
4I42
PDB:
4ELX
PDB:
4ELW
PDB:
4ELS
PDB:
3T88
PFAM:
PF00378
PRIDE:
P0ABU0
PRODB:
PRO_000023201
PROSITE:
PS00166
REFSEQ:
NP_416765
SMR:
P0ABU0
SWISSMODEL:
P0ABU0
UNIPROT:
P0ABU0


Operon      
Name: menFDHBCE         
Operon arrangement:
Transcription unit        Promoter
menD-yfbB-menBCE
menBCE
menFD-yfbB-menBCE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter menBp 2376887 reverse nd [AIPP], [ICWHO] [1], [2]
  promoter TSS_2519 (cluster) 2376914 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Sharma V., Suvarna K., Meganathan R., Hudspeth ME., 1992, Menaquinone (vitamin K2) biosynthesis: nucleotide sequence and expression of the menB gene from Escherichia coli., J Bacteriol 174(15):5057-62

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB