RegulonDB RegulonDB 10.9: Gene Form
   

amyA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

amyA yedD fliT TSS_2266 TSS_2266 amyAp amyAp

Gene      
Name: amyA    Texpresso search in the literature
Synonym(s): ECK1926, EG11387, b1927, yedC
Genome position(nucleotides): 2006156 --> 2007643 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.8
External database links:  
ASAP:
ABE-0006414
CGSC:
30745
ECHOBASE:
EB1360
ECOLIHUB:
amyA
OU-MICROARRAY:
b1927
STRING:
511145.b1927
COLOMBOS: amyA


Product      
Name: α-amylase
Synonym(s): AmyA, YedC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 56.639
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
416 -> 491 HPNCIAFSRSGTDEFPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQERVVTDENGEATFFCNGGSVSVWVI
109 -> 109 A
149 -> 149 Q
29 -> 367 DGFNDIGINMVWLPPAYKGASGGYSVGYDSYDLFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRVNADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVNDYTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHIPAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEASRMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLRENGVPSVFY
19 -> 20 KL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.4 - polysaccharides
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0103025 - alpha-amylase activity (releasing maltohexaose)
GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0043169 - cation binding
GO:0046872 - metal ion binding
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004556 - alpha-amylase activity
GO:0005509 - calcium ion binding
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH13
DIP:
DIP-9108N
ECOCYC:
ALPHA-AMYL-CYTO-MONOMER
ECOLIWIKI:
b1927
INTERPRO:
IPR013776
INTERPRO:
IPR017853
INTERPRO:
IPR013780
INTERPRO:
IPR006048
INTERPRO:
IPR006047
MODBASE:
P26612
PFAM:
PF00128
PFAM:
PF02806
PRIDE:
P26612
PRODB:
PRO_000022101
REFSEQ:
NP_416437
SMART:
SM00642
SMR:
P26612
UNIPROT:
P26612


Operon      
Name: amyA         
Operon arrangement:
Transcription unit        Promoter
amyA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2266 2006132 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB