RegulonDB RegulonDB 10.10: Gene Form
   

yijD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sthA trmA fabR yijD oxyR terminator TSS_4694 TSS_4694 TSS_4693 TSS_4693 TSS_4692 TSS_4692 TSS_4691 TSS_4691 TSS_4690 TSS_4690 TSS_4689 TSS_4689 TSS_4688 TSS_4688 sthAp sthAp

Gene      
Name: yijD    Texpresso search in the literature
Synonym(s): ECK3956, EG11395, b3964
Genome position(nucleotides): 4161771 --> 4162130 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.17
External database links:  
ASAP:
ABE-0012981
ECHOBASE:
EB1368
ECOLIHUB:
yijD
OU-MICROARRAY:
b3964
STRING:
511145.b3964
COLOMBOS: yijD


Product      
Name: DUF1422 domain-containing inner membrane protein YijD
Synonym(s): YijD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.023
Isoelectric point: 9.633
Motif(s):
 
Type Positions Sequence
3 -> 115 QANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVLTVYCLHQRYLNRTMPVGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRKQ
94 -> 94 F
9 -> 28 GTLLLALVAGLSINGTFAAL
32 -> 50 IVPFSVFPIISLVLTVYCL
62 -> 84 GLPGLAAACFILGVLLYSTVVRA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Savage DF., et al., 2007
External database links:  
ECOCYC:
EG11395-MONOMER
ECOLIWIKI:
b3964
INTERPRO:
IPR009867
PFAM:
PF07226
PRIDE:
P0AF40
REFSEQ:
NP_418399
UNIPROT:
P0AF40


Operon      
Name: fabR-yijD         
Operon arrangement:
Transcription unit        Promoter
fabR-yijD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4688 4161094 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4689 4161458 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4690 4161554 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4691 4161556 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4692 4161745 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4693 4162891 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4694 4162924 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Savage DF., Anderson CL., Robles-Colmenares Y., Newby ZE., Stroud RM., 2007, Cell-free complements in vivo expression of the E. coli membrane proteome., Protein Sci 16(5):966-76

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB