RegulonDB RegulonDB 10.10: Gene Form
   

holD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rsmC yjjG rimI holD rsmCp1 rsmCp1 holDp holDp rsmCp3 rsmCp3

Gene      
Name: holD    Texpresso search in the literature
Synonym(s): ECK4363, EG11414, b4372
Genome position(nucleotides): 4607803 --> 4608216 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.73
External database links:  
ASAP:
ABE-0014340
CGSC:
31460
ECHOBASE:
EB1386
ECOLIHUB:
holD
OU-MICROARRAY:
b4372
STRING:
511145.b4372
COLOMBOS: holD


Product      
Name: DNA polymerase III subunit ψ
Synonym(s): HolD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.174
Isoelectric point: 5.601
Motif(s):
 
Type Positions Sequence
3 -> 127 SRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRALTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAALWQQICT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003887 - DNA-directed DNA polymerase activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0008408 - 3'-5' exonuclease activity
GO:0016740 - transferase activity
biological_process GO:0006260 - DNA replication
GO:0009314 - response to radiation
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0071897 - DNA biosynthetic process
Reference(s): [1] Carter JR., et al., 1993
[2] Sargentini NJ., et al., 2016
[3] Svanberg Frisinger F., et al., 2021
[4] Xiao H., et al., 1993
External database links:  
DIP:
DIP-9934N
ECOCYC:
EG11414-MONOMER
ECOLIWIKI:
b4372
INTERPRO:
IPR004615
INTERPRO:
IPR018382
INTERPRO:
IPR036654
MINT:
P28632
MODBASE:
P28632
PDB:
3SXU
PDB:
3GLI
PDB:
1EM8
PFAM:
PF03603
PRIDE:
P28632
PRODB:
PRO_000022919
REFSEQ:
NP_418789
SMR:
P28632
UNIPROT:
P28632


Operon      
Name: holD-rimI-yjjG         
Operon arrangement:
Transcription unit        Promoter
holD-rimI-yjjG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rsmCp3 4607725 reverse nd [ICWHO] [5]
  promoter rsmCp1 4607868 reverse nd [ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Carter JR., Franden MA., Aebersold R., McHenry CS., 1993, Identification, isolation, and overexpression of the gene encoding the psi subunit of DNA polymerase III holoenzyme., J Bacteriol 175(17):5604-10

 [2] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [3] Svanberg Frisinger F., Jana B., Donadio S., Guardabassi L., 2021, In Silico Prediction and Prioritization of Novel Selective Antimicrobial Drug Targets in Escherichia coli., Antibiotics (Basel) 10(6)

 [4] Xiao H., Crombie R., Dong Z., Onrust R., O'Donnell M., 1993, DNA polymerase III accessory proteins. III. holC and holD encoding chi and psi., J Biol Chem 268(16):11773-8

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB