RegulonDB RegulonDB 10.9: Gene Form
   

ahr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ahr idnK leuX Fis ppGpp terminator anti-terminator anti-anti-terminator leuXp leuXp yjgBp8 yjgBp8 yjgBp9 yjgBp9 yjgBp5 yjgBp5 yjgBp10 yjgBp10

Gene      
Name: ahr    Texpresso search in the literature
Synonym(s): ECK4262, EG11436, b4269, yjgB
Genome position(nucleotides): 4495190 <-- 4496209 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.59
External database links:  
ASAP:
ABE-0013982
ECHOBASE:
EB1406
ECOLIHUB:
yjgB
OU-MICROARRAY:
b4269
STRING:
511145.b4269
COLOMBOS: ahr


Product      
Name: NADPH-dependent aldehyde reductase Ahr
Synonym(s): AdhZ3, Ahr, YjgB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.502
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
179 -> 301 GLGHIAIKLLHAMGCEVTAFSSNPAKEQEVLAMGADKVVNSRDPQALKALAGQFDLIINTVNVSLDWQPYFEALTYGGNFHTVGAVLTPLSVPAFTLIAGDRSVSGSATGTPYELRKLMRFAA
29 -> 137 QDVEVQVDYCGICHSDLSMIDNEWGFSQYPLVAGHEVIGRVVALGSAAQDKGLQVGQRVGIGWTARSCGHCDACISGNQINCEQGAVPTIMNRGGFAEKLRADWQWVIP
331 -> 339 YRVVLKADF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008270 - zinc ion binding
GO:0042803 - protein homodimerization activity
GO:0008106 - alcohol dehydrogenase (NADP+) activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0055114 - oxidation-reduction process
External database links:  
ECOCYC:
EG11436-MONOMER
ECOLIWIKI:
b4269
INTERPRO:
IPR020843
INTERPRO:
IPR036291
INTERPRO:
IPR029752
INTERPRO:
IPR013154
INTERPRO:
IPR013149
INTERPRO:
IPR011032
INTERPRO:
IPR002328
MODBASE:
P27250
PDB:
7BU2
PFAM:
PF08240
PFAM:
PF00107
PRIDE:
P27250
PROSITE:
PS00059
REFSEQ:
NP_418690
SMART:
SM00829
SMR:
P27250
UNIPROT:
P27250


Operon      
Name: ahr         
Operon arrangement:
Transcription unit        Promoter
yjgB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjgBp10 4496234 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjgBp5 4496266 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjgBp9 4496347 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjgBp8 4496349 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB