RegulonDB RegulonDB 10.8: Gene Form
   

emrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: emrB    Texpresso search in the literature
Synonym(s): ECK2680, EG11439, b2686
Genome position(nucleotides): 2812616 --> 2814154 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.6
External database links:  
ASAP:
ABE-0008840
CGSC:
33262
ECHOBASE:
EB1409
OU-MICROARRAY:
b2686
PortEco:
emrB
STRING:
511145.b2686
COLOMBOS: emrB


Product      
Name: multidrug efflux pump membrane subunit EmrB
Synonym(s): EmrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.624
Isoelectric point: 8.039
Motif(s):
 
Type Positions Sequence
19 -> 413 LSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIPLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVAVVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVVAVVAICFLIVWELTDDNPIVDLSLFKSRNFTIGCLCISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIG
203 -> 223 AVGLALLVIGIGSLQIMLDRG
13 -> 38 VIMTIALSLATFMQVLDSTIANVAIP
110 -> 128 VIQGIVAGPLIPLSQSLLL
482 -> 504 WMSAGIFLVLLGLVWFAKPPFGA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:1990281 - efflux pump complex
molecular_function GO:0015125 - bile acid transmembrane transporter activity
GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0015299 - solute:proton antiporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0048545 - response to steroid hormone
GO:0009636 - response to toxic substance
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
Reference(s): [1] Furukawa H., et al., 1993
[2] Pu Y., et al., 2016
External database links:  
ECOCYC:
EMRB-MONOMER
ECOLIWIKI:
b2686
INTERPRO:
IPR004638
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR011701
INTERPRO:
IPR001411
MODBASE:
P0AEJ0
PANTHER:
PTHR23501
PFAM:
PF07690
PRIDE:
P0AEJ0
PRODB:
PRO_000022510
PROSITE:
PS50850
REFSEQ:
NP_417171
SMR:
P0AEJ0
UNIPROT:
P0AEJ0


Operon      
Name: mprA-emrAB         
Operon arrangement:
Transcription unit        Promoter
emrRAB


Transcriptional Regulation      
Display Regulation             
Repressed by: MprA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB