RegulonDB RegulonDB 11.0: Gene Form
   

scpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

scpA argK argP scpB

Gene      
Name: scpA    Texpresso search in the literature
Synonym(s): ECK2913, EG11444, b2917, sbm, yliK
Genome position(nucleotides): 3060850 --> 3062994
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.97
External database links:  
ASAP:
ABE-0009577
ECHOBASE:
EB1414
ECOLIHUB:
scpA
MIM:
251000
OU-MICROARRAY:
b2917
STRING:
511145.b2917
COLOMBOS: scpA


Product      
Name: methylmalonyl-CoA mutase
Synonym(s): Sbm, ScpA, YliK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 77.871
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence Comment
28 -> 539 QTAEGIAIKPLYTEADLDNLEVTGTLPGLPPYVRGPRATMYTAQPWTIRQYAGFSTAKESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDNPRVAGDVGKAGVAIDTVEDMKVLFDQIPLDKMSVSMTMNGAVLPVLAFYIVAAEEQGVTPDKLTGTIQNDILKEYLCRNTYIYPPKPSMRIIADIIAWCSGNMPRFNTISISGYHMGEAGANCVQQVAFTLADGIEYIKAAISAGLKIDDFAPRLSFFFGIGMDLFMNVAMLRAARYLWSEAVSGFGAQDPKSLALRTHCQTSGWSLTEQDPYNNVIRTTIEALAATLGGTQSLHTNAFDEALGLPTDFSARIARNTQIIIQEESELCRTVDPLAGSYYIESLTDQIVKQARAIIQQIDEAGGMAKAIEAGLPKRMIEEASAREQSLIDQGKRVIVGVNKYKLDHEDETDVLEIDNVMVRNEQIASLERIRATRDDAAVTAALNALTHAAQHNENLLAAAVNAARVRATLGEISDALEVAF
356 -> 356 A UniProt: In Ref. 1; CAA47311..
584 -> 714 RPRILIAKMGQDGHDRGAKVIASAYSDLGFDVDLSPMFSTPEEIARLAVENDVHVVGASSLAAGHKTLIPELVEALKKWGREDICVVAGGVIPPQDYAFLQERGVAAIYGPGTPMLDSVRDVLNLISQHHD UniProt: B12-binding.
586 -> 700 RILIAKMGQDGHDRGAKVIASAYSDLGFDVDLSPMFSTPEEIARLAVENDVHVVGASSLAAGHKTLIPELVEALKKWGREDICVVAGGVIPPQDYAFLQERGVAAIYGPGTPMLD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0016866 - intramolecular transferase activity
GO:0046872 - metal ion binding
GO:0004494 - methylmalonyl-CoA mutase activity
GO:0031419 - cobalamin binding
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P27253
ECOCYC:
METHYLMALONYL-COA-MUT-MONOMER
ECOLIWIKI:
b2917
INTERPRO:
IPR006099
INTERPRO:
IPR036724
INTERPRO:
IPR006159
INTERPRO:
IPR006158
INTERPRO:
IPR006098
INTERPRO:
IPR016176
MODBASE:
P27253
PFAM:
PF01642
PFAM:
PF02310
PRIDE:
P27253
PRODB:
PRO_000023912
PROSITE:
PS00544
PROSITE:
PS51332
REFSEQ:
NP_417392
SMR:
P27253
SWISSMODEL:
P27253
UNIPROT:
P27253


Operon      
Name: scpA-argK-scpBC         
Operon arrangement:
Transcription unit        Promoter
scpA-argK-scpBC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB