RegulonDB RegulonDB 10.9: Gene Form
   

argK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

scpA argK argP scpB

Gene      
Name: argK    Texpresso search in the literature
Synonym(s): ECK2914, EG11445, b2918, ygfD
Genome position(nucleotides): 3062987 --> 3063982 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.92
External database links:  
ASAP:
ABE-0009579
ECHOBASE:
EB1415
ECOLIHUB:
argK
MIM:
251100
OU-MICROARRAY:
b2918
STRING:
511145.b2918
COLOMBOS: argK


Product      
Name: methylmalonyl-CoA mutase-interacting GTPase YgfD
Synonym(s): ArgK, GTPase that interacts with methylmalonyl-CoA mutase, YgfD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.704
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
61 -> 68 GTPGAGKS
154 -> 154 T
22 -> 294 LAQAMTLVESRHPRHQALSTQLLDAIMPYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVTGGSILGDKTRMNDLARAEAAFIRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVARMVDCFISLQIAGGGDDLQGIKKGLMEVADLIVINKDDGDNHTNVAIARHMYESALHILRRKYDEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANE
68 -> 68 S

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005524 - ATP binding
GO:0005525 - GTP binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11445-MONOMER
ECOLIWIKI:
b2918
INTERPRO:
IPR027417
INTERPRO:
IPR005129
MODBASE:
P27254
PANTHER:
PTHR23408
PDB:
2P67
PFAM:
PF03308
PRIDE:
P27254
PRODB:
PRO_000022132
REFSEQ:
NP_417393
SMR:
P27254
UNIPROT:
P27254


Operon      
Name: scpA-argK-scpBC         
Operon arrangement:
Transcription unit        Promoter
scpA-argK-scpBC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB