RegulonDB RegulonDB 10.9: Gene Form
   

rffH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wecE rffG rffH rffC

Gene      
Name: rffH    Texpresso search in the literature
Synonym(s): ECK3781, EG11454, b3789, yifG
Genome position(nucleotides): 3973608 --> 3974489 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.1
External database links:  
ASAP:
ABE-0012379
ECHOBASE:
EB1423
ECOLIHUB:
rffH
MIM:
615350
MIM:
615351
MIM:
615352
OU-MICROARRAY:
b3789
STRING:
511145.b3789
COLOMBOS: rffH


Product      
Name: dTDP-glucose pyrophosphorylase 2
Synonym(s): RffH, YifG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.734
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
68 -> 69 GS
130 -> 131 AT
2 -> 238 KGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEASTFVQ
5 -> 5 I

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.4 - enterobacterial common antigen (surface glycolipid)
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008879 - glucose-1-phosphate thymidylyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0009058 - biosynthetic process
GO:0009243 - O antigen biosynthetic process
GO:0009246 - enterobacterial common antigen biosynthetic process
GO:0045226 - extracellular polysaccharide biosynthetic process
External database links:  
DIP:
DIP-10689N
ECOCYC:
DTDPGLUCOSEPP2-MONOMER
ECOLIWIKI:
b3789
INTERPRO:
IPR005835
INTERPRO:
IPR029044
INTERPRO:
IPR005907
MODBASE:
P61887
PANTHER:
PTHR43532
PDB:
1MC3
PFAM:
PF00483
PRIDE:
P61887
PRODB:
PRO_000023784
REFSEQ:
NP_418236
SMR:
P61887
UNIPROT:
P61887


Operon      
Name: rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM         
Operon arrangement:
Transcription unit        Promoter
rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB