RegulonDB RegulonDB 10.9: Gene Form
   

rffC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wecE rffG rffH rffC

Gene      
Name: rffC    Texpresso search in the literature
Synonym(s): ECK3782, EG11455, b3790, rff, wecD, yifH
Genome position(nucleotides): 3974467 --> 3975141 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0012382
ECHOBASE:
EB1424
ECOLIHUB:
rffC
OU-MICROARRAY:
b3790
STRING:
511145.b3790
COLOMBOS: rffC


Product      
Name: dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase
Synonym(s): Rff, RffC, WecD, YifH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 24.22
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence
187 -> 187 A
168 -> 174 LAGRGAG
94 -> 224 PALRQLASAAFAQSRFRAPWYAPDASSRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDARIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
biological_process GO:0009246 - enterobacterial common antigen biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
TDPFUCACTRANS-MONOMER
ECOLIWIKI:
b3790
INTERPRO:
IPR002110
INTERPRO:
IPR020683
INTERPRO:
IPR016181
INTERPRO:
IPR012752
INTERPRO:
IPR000182
MODBASE:
P27832
PRIDE:
P27832
PROSITE:
PS51186
REFSEQ:
YP_026256
SMR:
P27832
UNIPROT:
P27832


Operon      
Name: rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM         
Operon arrangement:
Transcription unit        Promoter
rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB