RegulonDB RegulonDB 10.9: Gene Form
   

narQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acrD aegA narQ BaeR CpxR CpxR EvgA CpxR CRP anti-terminator terminator acrDp2 acrDp2 acrDp acrDp narQp narQp

Gene      
Name: narQ    Texpresso search in the literature
Synonym(s): ECK2464, EG11460, b2469
Genome position(nucleotides): 2585731 --> 2587431 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.62
External database links:  
ASAP:
ABE-0008132
CGSC:
36333
ECHOBASE:
EB1429
ECOLIHUB:
narQ
OU-MICROARRAY:
b2469
STRING:
511145.b2469
COLOMBOS: narQ


Product      
Name: sensory histidine kinase NarQ
Synonym(s): NarQ, nitrate/nitrite sensor kinase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 63.697
Isoelectric point: 6.707
Motif(s):
 
Type Positions Sequence
32 -> 126 TLASSLRDAEAINIAGSLRMQSYRLGYDLQSGSPQLNAHRQLFQQALHSPVLTNLNVWYVPEAVKTRYAHLNANWLEMNNRLSKGDLPWYQANIN
172 -> 223 IRHQVVAPLNQLVTASQRIEHGQFDSPPLDTNLPNELGLLAKTFNQMSSELH
361 -> 425 ERATIARELHDSLAQVLSYLRIQLTLLKRSIPEDNATAQSIMADFSQALNDAYRQLRELLTTFRL
14 -> 34 AFFYIVLLSILSTGIALLTLA
147 -> 167 MLLVVAISLAGGIGIFTLVFF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0046983 - protein dimerization activity
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0018106 - peptidyl-histidine phosphorylation
GO:0042128 - nitrate assimilation
GO:0023014 - signal transduction by protein phosphorylation
GO:0071249 - cellular response to nitrate
GO:0071250 - cellular response to nitrite
External database links:  
DIP:
DIP-10318N
ECOCYC:
NARQ-MONOMER
ECOLIWIKI:
b2469
INTERPRO:
IPR036890
INTERPRO:
IPR029095
INTERPRO:
IPR016380
INTERPRO:
IPR011712
INTERPRO:
IPR003594
INTERPRO:
IPR003660
INTERPRO:
IPR005467
INTERPRO:
IPR042295
MODBASE:
P27896
PDB:
5IJI
PDB:
5JEQ
PDB:
5JGP
PDB:
5JEF
PDB:
6YUE
PDB:
6XYN
PFAM:
PF02518
PFAM:
PF07730
PFAM:
PF00672
PFAM:
PF13675
PRIDE:
P27896
PRODB:
PRO_000023358
PROSITE:
PS50109
PROSITE:
PS50885
REFSEQ:
NP_416964
SMART:
SM00387
SMART:
SM00304
SMR:
P27896
UNIPROT:
P27896


Operon      
Name: narQ         
Operon arrangement:
Transcription unit        Promoter
narQ


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB