RegulonDB RegulonDB 10.10: Gene Form
   

yigF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

corA yigF yigG yigFp4 yigFp4 yigFp5 yigFp5

Gene      
Name: yigF    Texpresso search in the literature
Synonym(s): ECK3811, EG11464, b3817
Genome position(nucleotides): 4002419 <-- 4002799 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
34.91
External database links:  
ASAP:
ABE-0012466
ECHOBASE:
EB1432
ECOLIHUB:
yigF
OU-MICROARRAY:
b3817
STRING:
511145.b3817
COLOMBOS: yigF


Product      
Name: DUF2628 domain-containing protein YigF
Synonym(s): YigF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.549
Isoelectric point: 10.058
Motif(s):
 
Type Positions Sequence
16 -> 117 KYRFNFYDQHGFPGFWGATPEYKAAFKALKVRQRLTIQMNFIAFFCSWIYLFVLGLWKKAIIVLLLGILSLFVGALIGVNILGIAVAAYVAVNTNKWFYEKE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11464-MONOMER
ECOLIWIKI:
b3817
INTERPRO:
IPR024399
PFAM:
PF10947
PRIDE:
P27842
REFSEQ:
NP_418261
UNIPROT:
P27842


Operon      
Name: yigGF         
Operon arrangement:
Transcription unit        Promoter
yigGF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yigFp5 4002842 reverse nd [ICWHO] [1]
  promoter yigFp4 4002875 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB