RegulonDB RegulonDB 10.9: Gene Form
   

wzxE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wzyE wzxE wecE wecF TSS_4448 TSS_4448 TSS_4447 (cluster) TSS_4447 (cluster) TSS_4446 TSS_4446 TSS_4445 (cluster) TSS_4445 (cluster)

Gene      
Name: wzxE    Texpresso search in the literature
Synonym(s): ECK3784, EG11486, b3792, wzx, yifJ
Genome position(nucleotides): 3976278 --> 3977528 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.64
External database links:  
ASAP:
ABE-0012386
ECHOBASE:
EB1449
ECOLIHUB:
wzxE
OU-MICROARRAY:
b3792
STRING:
511145.b3792
COLOMBOS: wzxE


Product      
Name: lipid III flippase
Synonym(s): Wzx, WzxE, YifJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.96
Isoelectric point: 10.262
Motif(s):
 
Type Positions Sequence
18 -> 38 IGAGLLVGKLLAVSFGPAGLG
145 -> 165 AAGNALSLIVGSLIGVLAYYV
335 -> 355 AWQLVGDVLKVGAYVFGYLVI
4 -> 283 AKASLWTAASTLVKIGAGLLVGKLLAVSFGPAGLGLAANFRQLITVLGVLAGAGIFNGVTKYVAQYHDNPQQLRRVVGTSSAMVLGFSTLMALVFVLAAAPISQGLFGNTDYQGLVRLVALVQMGIAWGNLLLALMKGFRDAAGNALSLIVGSLIGVLAYYVSYRLGGYEGALLGLALIPALVVIPAAIMLIKRGVIPLSYLKPSWDNGLAGQLSKFTLMALITSVTLPVAYIMMRKLLAAQYSWDEVGIWQGVSSISDAYLQFITASFSVYLLPTLSRL
175 -> 195 ALLGLALIPALVVIPAAIMLI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.4 - enterobacterial common antigen (surface glycolipid)
  4 - transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0009246 - enterobacterial common antigen biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Beppler J., et al., 2016
[2] McBroom AJ., et al., 2006
External database links:  
ECOCYC:
EG11486-MONOMER
ECOLIWIKI:
b3792
INTERPRO:
IPR032896
INTERPRO:
IPR002797
PFAM:
PF01943
PRIDE:
P0AAA7
PRODB:
PRO_000024225
REFSEQ:
NP_418239
UNIPROT:
P0AAA7


Operon      
Name: rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM         
Operon arrangement:
Transcription unit        Promoter
rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4445 (cluster) 3977392 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4446 3979755 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4447 (cluster) 3979832 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4448 3979835 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Beppler J., Mkaddem SB., Michaloski J., Honorato RV., Velasco IT., de Oliveira PS., Giordano RJ., Monteiro RC., Pinheiro da Silva F., 2016, Negative regulation of bacterial killing and inflammation by two novel CD16 ligands., Eur J Immunol 46(8):1926-35

 [2] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB