RegulonDB RegulonDB 10.9: Gene Form
   

prmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

panF dusB prmA yhdT Fis Fis CRP Fis Fis IHF Fis CRP Fis CRP DksA-ppGpp DksA-ppGpp ppGpp TSS_3598 TSS_3598 TSS_3597 TSS_3597 dusBp dusBp TSS_3596 TSS_3596 TSS_3595 TSS_3595 TSS_3594 TSS_3594 TSS_3593 TSS_3593 TSS_3592 TSS_3592 TSS_3591 TSS_3591

Gene      
Name: prmA    Texpresso search in the literature
Synonym(s): ECK3246, EG11497, b3259, prm-1, yhdI
Genome position(nucleotides): 3409070 --> 3409951 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.31
External database links:  
ASAP:
ABE-0010697
CGSC:
366
ECHOBASE:
EB1460
ECOLIHUB:
prmA
OU-MICROARRAY:
b3259
STRING:
511145.b3259
COLOMBOS: prmA


Product      
Name: ribosomal protein L11 methyltransferase
Synonym(s): PrmA, YhdI, methylase for 50S ribosomal subunit protein L11, methyltransferase for 50S ribosomal subunit protein L11, methyltransferase of 50S ribosomal subunit protein L11
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.877
Isoelectric point: 4.075
Motif(s):
 
Type Positions Sequence
3 -> 292 WIQLKLNTTGANAEDLSDALMEAGAVSITFQDTHDTPVFEPLPGETRLWGDTDVIGLFDAETDMNDVVAILENHPLLGAGFAHKIEQLEDKDWEREWMDNFHPMRFGERLWICPSWRDVPDENAVNVMLDPGLAFGTGTHPTTSLCLQWLDSLDLTGKTVIDFGCGSGILAIAALKLGAAKAIGIDIDPQAIQASRDNAERNGVSDRLELYLPKDQPEEMKADVVVANILAGPLRELAPLISVLPVSGGLLGLSGILASQAESVCEAYADSFALDPVVEKEEWCRITGRK
78 -> 78 L
285 -> 285 W

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0071885 - N-terminal protein N-methyltransferase activity
GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0008276 - protein methyltransferase activity
GO:0016740 - transferase activity
GO:0016279 - protein-lysine N-methyltransferase activity
biological_process GO:0006479 - protein methylation
GO:0018012 - N-terminal peptidyl-alanine trimethylation
GO:0018023 - peptidyl-lysine trimethylation
GO:0032259 - methylation
Note(s): Note(s): ...[more].
Reference(s): [1] Bujnicki JM. 2000
External database links:  
DIP:
DIP-47862N
ECOCYC:
EG11497-MONOMER
ECOLIWIKI:
b3259
INTERPRO:
IPR004498
INTERPRO:
IPR029063
MODBASE:
P0A8T1
PFAM:
PF06325
PRIDE:
P0A8T1
PRODB:
PRO_000023595
REFSEQ:
NP_417725
SMR:
P0A8T1
SWISSMODEL:
P0A8T1
UNIPROT:
P0A8T1


Operon      
Name: yhdT-panF-prmA         
Operon arrangement:
Transcription unit        Promoter
yhdT-panF-prmA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3591 3408793 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3592 3408983 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3593 3409040 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3594 3409063 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3595 3409159 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3596 3409381 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3597 3410248 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3598 3410739 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bujnicki JM., 2000, Sequence, structural, and evolutionary analysis of prokaryotic ribosomal protein L11 methyltransferases., Acta Microbiol Pol 49(1):19-29

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB