RegulonDB RegulonDB 10.9: Gene Form
   

yhdJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhdJ fis yhdU terminator anti-terminator anti-anti-terminator yhdUp1 yhdUp1 yhdJp2 yhdJp2

Gene      
Name: yhdJ    Texpresso search in the literature
Synonym(s): ECK3249, EG11498, b3262, ccrM
Genome position(nucleotides): 3411653 --> 3412537 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.46
External database links:  
ASAP:
ABE-0010706
ECHOBASE:
EB1461
ECOLIHUB:
yhdJ
OU-MICROARRAY:
b3262
STRING:
511145.b3262
COLOMBOS: yhdJ


Product      
Name: DNA adenine methyltransferase
Synonym(s): CcrM, YhdJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.397
Isoelectric point: 9.151
Motif(s):
 
Type Positions Sequence
34 -> 250 VDLIFADPPYNIGKNFDGLIEAWKEDLFIDWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKLFTIKSRIVWSYDSSGVQAKKHYGSMYEPILMMVKDAKNYTFNGDAILVEAKTGSQRALIDYRKNPPQPYNHQKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVAIASGRKFIGIEINSEYIK
28 -> 28 K

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0008168 - methyltransferase activity
GO:0008170 - N-methyltransferase activity
GO:0016740 - transferase activity
GO:0009007 - site-specific DNA-methyltransferase (adenine-specific) activity
biological_process GO:0006306 - DNA methylation
GO:0032259 - methylation
GO:0032775 - DNA methylation on adenine
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12296N
ECOCYC:
EG11498-MONOMER
ECOLIWIKI:
b3262
INTERPRO:
IPR001091
INTERPRO:
IPR002052
INTERPRO:
IPR029063
INTERPRO:
IPR002941
MODBASE:
P28638
PFAM:
PF01555
PRIDE:
P28638
PRINTS:
PR00508
PROSITE:
PS00092
REFSEQ:
NP_417728
SMR:
P28638
UNIPROT:
P28638


Operon      
Name: yhdJ         
Operon arrangement:
Transcription unit        Promoter
yhdJ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhdJp2 3411617 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yhdUp1 3412497 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB